BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303F03f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|... 27 2.2 SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||... 26 3.9 SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces ... 26 3.9 SPBC36B7.08c |||nucleosome assembly protein |Schizosaccharomyces... 25 5.2 SPCC1322.01 ||SPCC23B6.06|3'-5' exonuclease for RNA 3' ss-tail|S... 25 5.2 SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe... 25 6.8 SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyce... 25 9.0 >SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1469 Score = 26.6 bits (56), Expect = 2.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 174 YFPFQWISFGFVLIAIFVPLF 112 Y PF W F ++ F+PLF Sbjct: 189 YSPFLWFYFFITIVGNFIPLF 209 >SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 710 Score = 25.8 bits (54), Expect = 3.9 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 399 ENGVQFDGIEIAEFKGYDLGLKASKDFTEGSLILTIPSKVM 521 +NGVQ+ ++ + + LK +K T G LTI ++V+ Sbjct: 67 KNGVQYGFVKFVNAESIEEVLKDAKGMTLGQRKLTIKARVV 107 >SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces pombe|chr 3|||Manual Length = 761 Score = 25.8 bits (54), Expect = 3.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 493 RDPSVKSFEALRPRSYPLNSAISIPSNWTP 404 R VK A+RPR+ PLN S P Sbjct: 508 RTSPVKELPAIRPRTIPLNGVAPYESELRP 537 >SPBC36B7.08c |||nucleosome assembly protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 244 Score = 25.4 bits (53), Expect = 5.2 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 381 YLQWL-RENGVQFDGIEIAEFKGYDLGLKASKDFTE 485 Y QW E FDG + F DL A K FTE Sbjct: 164 YFQWTGEEEDDDFDGATLTIFLAEDLFPNAVKYFTE 199 >SPCC1322.01 ||SPCC23B6.06|3'-5' exonuclease for RNA 3' ss-tail|Schizosaccharomyces pombe|chr 3|||Manual Length = 957 Score = 25.4 bits (53), Expect = 5.2 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -2 Query: 502 VKIRDPSVKSFEALRPRSYPLNSAISIPSNWTPFSLSHCKYLS 374 V +R P+V F+ L+ PL S +S+PS+ PF++ K +S Sbjct: 214 VLLRCPNV--FKKLKEVQQPL-SDVSVPSDVLPFTIKLLKKIS 253 >SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 182 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 207 LILFFSVGIIYYFPFQWISFGFVLIAIFVPLF 112 +I ++S I+YY P W+ LI + +P F Sbjct: 99 VIEYWSQLILYYVPVYWLLKAIFLIWLALPKF 130 >SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 681 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 454 RSYPLNSAISIPSNWTPFSLSHCK 383 R+Y L S ++ +N+ PF S CK Sbjct: 583 RAYNLKSHMNTHTNYRPFQCSICK 606 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,985,566 Number of Sequences: 5004 Number of extensions: 38121 Number of successful extensions: 80 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -