BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303E08f (472 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0772 - 23029703-23029715,23029835-23030463,23030637-230316... 29 1.9 03_01_0580 + 4293079-4293582,4293797-4294037,4294982-4295160,429... 28 4.4 >12_02_0772 - 23029703-23029715,23029835-23030463,23030637-23031673, 23031830-23032166 Length = 671 Score = 29.1 bits (62), Expect = 1.9 Identities = 21/44 (47%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = +1 Query: 166 INIYQH-FGFKI---INYLETFFGDDIR*KILSEFSVITR*NNY 285 I IYQH G K+ I YLETF G+ K+L E V NNY Sbjct: 454 ITIYQHNIGSKVEDMITYLETFLGESA--KVLWEQWVEKNPNNY 495 >03_01_0580 + 4293079-4293582,4293797-4294037,4294982-4295160, 4295319-4295674,4295761-4296100 Length = 539 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 360 VQNLNWLFPTSFLYNYPFALLWYNIEFSQI 449 V+ L+W+ P+ ++ PF L+Y+ FSQ+ Sbjct: 259 VRTLHWVVPSYSIWGLPF-FLFYSTRFSQL 287 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,971,952 Number of Sequences: 37544 Number of extensions: 225522 Number of successful extensions: 352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -