BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303E02f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ... 28 0.97 SPAP8A3.09c |paa1||protein phosphatase regulatory subunit Paa1|S... 27 1.7 >SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1427 Score = 27.9 bits (59), Expect = 0.97 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 1/86 (1%) Frame = +1 Query: 91 YLYISII-AF*LDA*KLFTAPSLSIVSFWEFFVSVGAFALLIPNDAVSLGRLLRVCVPFL 267 + +IS+ AF L +L + S W F V G+F LL+P A ++ L V +P Sbjct: 116 FSWISVANAFGLLLLRLISIYDFLTYSSWSFSVKGGSFLLLLPL-AYNITLFLLVIIP-- 172 Query: 268 VSVFPPASXRPALVWQRALLGARPPP 345 +F P + P + + + ARP P Sbjct: 173 --LFFPRAWSPTVKFSKV---ARPSP 193 >SPAP8A3.09c |paa1||protein phosphatase regulatory subunit Paa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 590 Score = 27.1 bits (57), Expect = 1.7 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 502 ERVMLVSLALGPDGGGDELRPLL 434 ER+ ++LALGP+ DEL P L Sbjct: 33 ERLSTIALALGPERTRDELIPFL 55 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,154,135 Number of Sequences: 5004 Number of extensions: 16002 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -