BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303E02f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 25 1.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 3.6 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 4.7 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 23 6.2 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 23 8.2 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 163 VSFWEFFVSVGAFALLIPNDAVSLGRLLRV 252 + F E GAF+L IP V GRL+++ Sbjct: 83 IKFAEAVPRRGAFSLFIPEHRVIAGRLIKL 112 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 3.6 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 496 VMLVSLALGPDGGGDELRPLLQLVFYILDKL 404 ++L SLAL + RP+LQ + Y +D++ Sbjct: 1315 ILLSSLALALEDVHLPQRPILQDILYYMDRI 1345 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 4.7 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 413 RQAQEVQAQQRGVS*VREASSEGGGG 336 R+A+E +AQQ+ S V ASSE G Sbjct: 1077 RRAREREAQQQNPSLVFSASSEATEG 1102 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 365 REASSEGGGGLAPRSARCQTRAG 297 R A+ GG + + C+TRAG Sbjct: 85 RRATEGNGGKSSTKGKECRTRAG 107 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 247 RVCVPFLVSVFPPASXRPA 303 RVC + S+FPP RPA Sbjct: 33 RVCEE-IESIFPPGDDRPA 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 291,085 Number of Sequences: 2352 Number of extensions: 4182 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -