Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS303E02f
         (521 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z35604-4|CAA84678.1|  442|Caenorhabditis elegans Hypothetical pr...    60   1e-09

>Z35604-4|CAA84678.1|  442|Caenorhabditis elegans Hypothetical
           protein ZK1058.4 protein.
          Length = 442

 Score = 59.7 bits (138), Expect = 1e-09
 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = -2

Query: 520 TKPPETERVMLVSLALGPDGGGDE-LRPLLQLVFYILDKLKRFKLSKEALAKCEKRRQKV 344
           T+ PE +R M VSL L   G  +E +  +L LVFY++DK ++ KLSK+A  K E+RR++ 
Sbjct: 318 TRLPEAQRYMFVSLNLQYLGQDEESVMEILNLVFYLIDKARKMKLSKDAKVKAERRRKEF 377

Query: 343 AEAWLRGAH 317
            +A+L+  H
Sbjct: 378 EDAFLKQTH 386


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,588,295
Number of Sequences: 27780
Number of extensions: 97294
Number of successful extensions: 347
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 341
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 346
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1017709248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)