BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303E01f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1049 + 8275837-8275859,8276428-8276503,8276545-8276634,827... 30 1.3 05_07_0105 - 27716126-27716218,27716548-27716658,27716764-277168... 29 3.0 05_05_0290 - 23879064-23880035 29 3.0 04_04_1191 + 31599067-31600194 29 3.0 05_05_0174 - 22960732-22960815,22960907-22961419,22961576-229620... 28 4.0 01_01_0274 - 2263304-2264211,2264490-2264673 28 4.0 07_03_0433 - 18169930-18170029,18171183-18171307,18172192-181723... 28 5.2 05_07_0366 + 29691093-29691590 28 5.2 10_08_0949 - 21759821-21759833,21759985-21760301,21760650-217607... 27 6.9 10_04_0009 + 7477914-7478411 27 6.9 07_01_0461 + 3492302-3492413,3492868-3492964,3493053-3493131,349... 27 6.9 03_02_0291 + 7148768-7148853,7148966-7149170,7149823-7150238,715... 27 6.9 01_07_0005 + 40364385-40364732,40365299-40365448 27 6.9 09_06_0274 + 21967740-21968230,21968411-21968550,21968711-219689... 27 9.1 09_04_0291 + 16433097-16433942,16434708-16434851,16435226-164353... 27 9.1 06_01_1088 - 8926361-8927301,8927437-8927705,8927850-8929023,892... 27 9.1 04_02_0002 + 8412568-8412781,8412915-8413015,8413114-8413185,841... 27 9.1 >01_01_1049 + 8275837-8275859,8276428-8276503,8276545-8276634, 8276721-8276836,8276918-8277017,8277808-8277879, 8277954-8278001,8278093-8278170,8278272-8278391, 8278496-8278601,8279574-8279737,8280403-8280537, 8280766-8280896,8282016-8282094,8282284-8282373 Length = 475 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 352 LDGLHDPVDDLVLDTGILTLGVLSDRDHVNVV 257 L G+ PVDDL D ++ G++ D+D N+V Sbjct: 47 LKGMGFPVDDLEFDPDLVIRGLIMDKDKGNLV 78 >05_07_0105 - 27716126-27716218,27716548-27716658,27716764-27716815, 27716895-27717034,27717298-27717422,27717514-27717638, 27717853-27717898,27718374-27718947 Length = 421 Score = 28.7 bits (61), Expect = 3.0 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +2 Query: 236 EGIKTLYDNVDVVTIRENTEGEYSGIEHEIVDGVVQSIKLITEEA-STRVAEFAFQFARE 412 E ++ L + D+V N +G+ IE EI+DGVV +++ + ST V + A + Sbjct: 255 EALQKLNKHYDIVV---NIQGDEPLIEPEIIDGVVMALQRAPDAVFSTAVTALKPEDASD 311 Query: 413 NKRKK 427 R K Sbjct: 312 TNRVK 316 >05_05_0290 - 23879064-23880035 Length = 323 Score = 28.7 bits (61), Expect = 3.0 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 403 ELEGELR-HSRTGLLRDQLDGLHDPV-DDLVLDTGIL 299 E EG +R H R LR LD +HD + DD D+ IL Sbjct: 81 EFEGFIRRHRRASTLRRVLDSIHDDLADDQERDSSIL 117 >04_04_1191 + 31599067-31600194 Length = 375 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 120 LLAFTESIAFWGIPNLPSGPLTAVTSTS 37 LL E + FWG+PNL S P + TS Sbjct: 290 LLTSLERLNFWGLPNLLSLPANLASLTS 317 >05_05_0174 - 22960732-22960815,22960907-22961419,22961576-22962058, 22964191-22964673 Length = 520 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +2 Query: 110 NANKIGLKGPLMTPVGKGYRSLNLALRKEFDLYANVRPCKSLEGIKTL 253 +A +GL + P+G+G+ +L+ ++ F L + P SL G+ +L Sbjct: 337 SALNVGLGVGAILPLGRGFMNLSSSVPDRFYLGGHSSPVCSLSGLSSL 384 >01_01_0274 - 2263304-2264211,2264490-2264673 Length = 363 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 373 TGLLRDQLDGLHDPVDDLVLDTGILTLGV 287 TGLL ++GL D VDDLV L +GV Sbjct: 214 TGLLCAGMEGLDDGVDDLVAGIDDLEVGV 242 >07_03_0433 - 18169930-18170029,18171183-18171307,18172192-18172358, 18173027-18173081,18173409-18173491,18173493-18173622, 18174482-18174691 Length = 289 Score = 27.9 bits (59), Expect = 5.2 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -3 Query: 384 ATLVLASSVISLMDCTTPSTISCSIPE-YSPSVFSLIVTTSTLSYSVLI 241 A+L+ +S+ISLMDC P I +PE S +F L T T ++S+L+ Sbjct: 129 ASLLKLTSLISLMDCRYPIEI-FPLPEGASLGIFQLEKTFKT-TFSLLV 175 >05_07_0366 + 29691093-29691590 Length = 165 Score = 27.9 bits (59), Expect = 5.2 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = -2 Query: 520 CPGTWWRARDNSAGRGRLTSXHNI---SFVYSRDLLPLVFSG 404 C WWR R GRGR N + V D LP VF G Sbjct: 76 CRERWWRRRPAHRGRGRGGRRRNSGGNATVAGGDALPEVFVG 117 >10_08_0949 - 21759821-21759833,21759985-21760301,21760650-21760728, 21760816-21760912,21761305-21761410 Length = 203 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -2 Query: 97 RFLGNTEFAIWTPNSCYIHFLPFDRYF 17 RFL EF N YIH+L +RYF Sbjct: 17 RFLLELEFIQCLANPTYIHYLAQNRYF 43 >10_04_0009 + 7477914-7478411 Length = 165 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -2 Query: 520 CPGTWWRARDNSAGRGRLTSXHNI---SFVYSRDLLPLVFSG 404 C WW+ R GRGR N + V D LP VF+G Sbjct: 76 CRERWWQRRPAHRGRGRGGRRRNSGGNATVAGGDALPEVFAG 117 >07_01_0461 + 3492302-3492413,3492868-3492964,3493053-3493131, 3493484-3493794,3494219-3494231 Length = 203 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -2 Query: 97 RFLGNTEFAIWTPNSCYIHFLPFDRYF 17 RFL EF N YIH+L +RYF Sbjct: 19 RFLLELEFIQCLANPTYIHYLAQNRYF 45 >03_02_0291 + 7148768-7148853,7148966-7149170,7149823-7150238, 7150325-7150631,7150722-7151186 Length = 492 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%) Frame = +2 Query: 2 IFEAAKVPIEWE------EVDVTAVRGPDGKFGI-PQKAIDSVNANKI 124 I A V + WE EV++ V+ DG + + P+KA+D VN N I Sbjct: 157 IITGANVQVCWEKFARYFEVELKEVKLRDGYYVMDPEKAVDMVNENTI 204 >01_07_0005 + 40364385-40364732,40365299-40365448 Length = 165 Score = 27.5 bits (58), Expect = 6.9 Identities = 19/70 (27%), Positives = 29/70 (41%) Frame = -3 Query: 456 IILALCTAVTFFLLFSLANWKANSATLVLASSVISLMDCTTPSTISCSIPEYSPSVFSLI 277 + L LC +VTF + L W A A L S+ +S + + + + SLI Sbjct: 65 VALMLCGSVTFAIGLLLMPWVAGVALLFGLSAAVSTLSSGVFGKAAAAASSPVVTDLSLI 124 Query: 276 VTTSTLSYSV 247 +T SV Sbjct: 125 ITIKIFKRSV 134 >09_06_0274 + 21967740-21968230,21968411-21968550,21968711-21968905, 21969524-21969652,21970063-21970218,21970507-21970589, 21972229-21972433,21972601-21972805,21973059-21973194, 21973990-21974164,21974470-21974528,21974642-21974716, 21974804-21974920,21975010-21975080,21975170-21975473, 21975721-21976086,21976404-21976514 Length = 1005 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 445 FVYSRDLLPLVFSGELEGELRHSRT 371 +VY R+LLP +G EG++ H T Sbjct: 175 YVYHRELLPRKVNGPWEGKISHIAT 199 >09_04_0291 + 16433097-16433942,16434708-16434851,16435226-16435390, 16435551-16435562 Length = 388 Score = 27.1 bits (57), Expect = 9.1 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = -3 Query: 300 SPSVFSLIVTT-STLSYSV----LIPSKLLQGLTLAYKSNSFLRAKL 175 +P++ S +VT+ TL Y L P+KLL+GL +YK+ L+ L Sbjct: 257 APNLLSAMVTSLETLDYYYYALPLSPTKLLKGLPSSYKNLKRLKVHL 303 >06_01_1088 - 8926361-8927301,8927437-8927705,8927850-8929023, 8929132-8929399 Length = 883 Score = 27.1 bits (57), Expect = 9.1 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 6/76 (7%) Frame = -3 Query: 411 SLANWKANSATLVLASSVISLMDCTTPSTIS-CSIPEYSPSVFSL-IVTTSTLSYSVLIP 238 S ++ +N T + + I L C + C PEY PS+ S+ I ++S L S+ + Sbjct: 752 SSSSSSSNGTTCLSGLTYIGLYSCEDLQNLDRCLSPEYLPSIKSIEIDSSSDLGLSMPVD 811 Query: 237 S----KLLQGLTLAYK 202 S K LQ L + K Sbjct: 812 SFVGFKYLQDLKIHCK 827 >04_02_0002 + 8412568-8412781,8412915-8413015,8413114-8413185, 8413267-8413380,8414248-8414269,8414450-8414598, 8415054-8415203,8415369-8415401,8418268-8418474 Length = 353 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 445 FVYSRDLLPLVFSGELEGELRHSRT 371 +VY R+LLP +G EG++ H T Sbjct: 36 YVYHRELLPRKVNGPWEGKISHIAT 60 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,869,412 Number of Sequences: 37544 Number of extensions: 259787 Number of successful extensions: 849 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -