BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303D12f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 114 9e-27 SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 30 0.24 SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc... 27 1.7 SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 26 3.9 SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 5.2 SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp... 25 9.0 SPBC36B7.04 |||tRNA dihydrouridine synthase Dus1 |Schizosaccharo... 25 9.0 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 114 bits (274), Expect = 9e-27 Identities = 57/102 (55%), Positives = 74/102 (72%) Frame = -3 Query: 375 KSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKFLW 196 KSAIN+VVTR+YT+++HKRL+GV FKKRAPRAIKEI FA+K M T ++RVD LNK +W Sbjct: 6 KSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKEVRVDPSLNKEVW 65 Query: 195 SKGVRNVPFXXXXXXXXXRNDDEDSAHKLFTLVTYVPVASIK 70 +G+RNVP R+D++D A L+T V V VA+ K Sbjct: 66 KRGIRNVPHRLRLRLSRKRSDEDDKA--LYTYVQAVDVANPK 105 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 29.9 bits (64), Expect = 0.24 Identities = 21/72 (29%), Positives = 31/72 (43%) Frame = +2 Query: 227 RMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTTSFMADLPFLSPLGLAI 406 R+ +P+ F R+ +G L PT R+ K Y TS M L +S LGL + Sbjct: 45 RLIHIPLSFLQQPRVIAEIIGGIVLGPTVMGRIPKFLDYI-FPTSSMGPLNLVSNLGLVL 103 Query: 407 VILSFVYRIQLR 442 + + LR Sbjct: 104 FLFVIGMEVDLR 115 >SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 27.1 bits (57), Expect = 1.7 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 202 EFV*ASVYSNVRSSHLFFSELSDFFDCSWGTLFKSNTMKSF 324 E V S+Y N R +L ++ CSW + +S+T S+ Sbjct: 68 EAVRDSIYQNKRGMYLAYAFGIAILACSWASAIQSSTTYSY 108 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.8 bits (54), Expect = 3.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 26 GVYSWLASTFSVCKPLID 79 GV WLAST+S C +++ Sbjct: 464 GVVCWLASTYSFCDGIVN 481 >SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 25.4 bits (53), Expect = 5.2 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 2 FFFFFYTKGVYSWLASTFSVCKPLID 79 FFF +Y K ++++ FS+ K L++ Sbjct: 74 FFFVYYCKQALEFISTVFSIIKFLLN 99 >SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Spt6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1365 Score = 24.6 bits (51), Expect = 9.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 366 INEVVTREYTVNLHKRLHGVGFKKRAPRAIKEI 268 INE VT +Y N+ + G+G ++A +K+I Sbjct: 860 INEAVTNKYEANILPYIAGLG-PRKADYVLKKI 891 >SPBC36B7.04 |||tRNA dihydrouridine synthase Dus1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 399 Score = 24.6 bits (51), Expect = 9.0 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 182 LTPL-DQRNLFKRVSTRMSGVPICFSANFRISLIALGARFLN 304 L P+ DQ L R+ R SG +C+S F L + N Sbjct: 22 LAPMVDQSELPWRILARRSGADLCYSPMFHSRLFGESEDYRN 63 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,060,760 Number of Sequences: 5004 Number of extensions: 39882 Number of successful extensions: 69 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -