BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303D10f (495 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 27 0.27 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 4.3 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 5.7 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 5.7 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 23 7.6 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 7.6 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 27.5 bits (58), Expect = 0.27 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 251 EAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 379 + G Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGGGQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 4.3 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -2 Query: 359 RRHPDRTYEYHHHGH 315 ++HP + +HHH H Sbjct: 175 QQHPGHSQHHHHHHH 189 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.0 bits (47), Expect = 5.7 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -2 Query: 362 YRRHPDRTYEYHHH--GHAEFGRQHVQYPMIQ 273 + HP + +HHH A+ H Q+ +IQ Sbjct: 498 HHAHPHHHHHHHHHHPTAADLAGYHHQHNVIQ 529 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.0 bits (47), Expect = 5.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 127 DGAGCSQAPPVRVQGAHPSGPG 192 DG +PP+ V G+ S PG Sbjct: 153 DGLHSIPSPPITVSGSDMSSPG 174 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 22.6 bits (46), Expect = 7.6 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 133 AGCSQAPPVRVQGAHPSGPGQ*CSRFY 213 +G + PP+ G P+GP FY Sbjct: 317 SGITGVPPIPADGPSPAGPYTNVPGFY 343 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 151 PPVRVQGAHPSGPGQ 195 PP+ +QG P GP Q Sbjct: 300 PPMPMQGGAPGGPPQ 314 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 487,513 Number of Sequences: 2352 Number of extensions: 10004 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -