BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303D04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 8e-18 SB_52425| Best HMM Match : Arm (HMM E-Value=9.7e-28) 70 1e-12 SB_3360| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.062 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) 32 0.33 SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) 31 0.58 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_20122| Best HMM Match : Arm (HMM E-Value=1.2e-24) 30 1.0 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 30 1.3 SB_57766| Best HMM Match : MFS_1 (HMM E-Value=2.4e-14) 30 1.3 SB_27138| Best HMM Match : Ebp2 (HMM E-Value=1.8) 30 1.3 SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_17370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_51370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_47670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) 29 3.1 SB_45305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_22495| Best HMM Match : DUF116 (HMM E-Value=8.1) 28 4.1 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 28 4.1 SB_47985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46871| Best HMM Match : PAN (HMM E-Value=1) 28 4.1 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 28 4.1 SB_38184| Best HMM Match : HisKA_2 (HMM E-Value=8.6) 28 4.1 SB_25304| Best HMM Match : HDV_ag (HMM E-Value=0.55) 28 4.1 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 28 5.4 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_27445| Best HMM Match : DUF227 (HMM E-Value=9.9) 28 5.4 SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) 27 7.1 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 27 9.4 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 27 9.4 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) 27 9.4 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 27 9.4 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) 27 9.4 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 27 9.4 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_23270| Best HMM Match : Vicilin_N (HMM E-Value=4.5) 27 9.4 SB_11650| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_4072| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 87.0 bits (206), Expect = 8e-18 Identities = 48/112 (42%), Positives = 71/112 (63%), Gaps = 6/112 (5%) Frame = +1 Query: 196 RMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTD 375 R+ +KN DV EMRRRR E V+LRK KREE + KRRNV ++ ++ + L T+D Sbjct: 689 RIKAYKNKSLDVSEMRRRREEEGVQLRKAKREEQMFKRRNVEVTRTSSTGSELEELLTSD 748 Query: 376 ------LDELVMNAANAENPEAQLAAVQQCRKLLSCDKNPPIDELIAAGILP 513 L + ++ A +++ E QLAA Q+ RK+LS + NPPID++I G++P Sbjct: 749 YMAEGPLFQDMVQAIISDDVEMQLAATQRFRKILSKEPNPPIDDVIKCGVIP 800 >SB_52425| Best HMM Match : Arm (HMM E-Value=9.7e-28) Length = 234 Score = 70.1 bits (164), Expect = 1e-12 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = +1 Query: 283 KREETLQKRRNVPISYSTDEEEIDKNLATTDLDELVMNAANAENPEAQLAAVQQCRKLLS 462 KRE+ +QKRRNVP+ +E D+ DL+ +VM A + ++P QL AVQ RKLLS Sbjct: 2 KREDCMQKRRNVPLELP---DEKDEKFQRRDLNAIVMEAGS-DDPSVQLGAVQAARKLLS 57 Query: 463 CDKNPPIDELI 495 DKNPPID+LI Sbjct: 58 KDKNPPIDDLI 68 >SB_3360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 34.3 bits (75), Expect = 0.062 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +1 Query: 193 NRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEE 348 NR ++K G V R RR +LRK +RE L +R I ++ +E E Sbjct: 2 NRKDLYKQGGHSVQAQRSRRRGQEADLRKERRERLLSSKR---IRFAEEEAE 50 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 32.3 bits (70), Expect = 0.25 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 4/97 (4%) Frame = +1 Query: 232 DEMRRRRNEVTVEL-RKNKREETLQKRRNVPISYSTDEEEIDK---NLATTDLDELVMNA 399 +++RRRR E L RK K E K R I D E + K + T + E + Sbjct: 3892 EKLRRRREEKEAALLRKQKEEAAKSKIRLDDIESKADVETLIKRQEGVQDTIIQEEITGT 3951 Query: 400 ANAENPEAQLAAVQQCRKLLSCDKNPPIDELIAAGIL 510 A +E +A + + R+ + + +D+L+A+G L Sbjct: 3952 ARSEG-QASNEEIGEYRRRMGDNFCSTVDDLVASGQL 3987 >SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06) Length = 965 Score = 31.9 bits (69), Expect = 0.33 Identities = 21/88 (23%), Positives = 41/88 (46%) Frame = +1 Query: 178 TDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDK 357 +DQ ++++VF ++ + V R+ N+ T R K + L N +++ T E I K Sbjct: 155 SDQESDQLYVFADSKEKVQVSRQHENQATT--RMIKPQWGLTSFDNKTVAFKTLTESIGK 212 Query: 358 NLATTDLDELVMNAANAENPEAQLAAVQ 441 + + LV + N E A+++ Sbjct: 213 EAEEIEKEVLVQKTVDHANGEVVNASLE 240 >SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) Length = 1494 Score = 31.1 bits (67), Expect = 0.58 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Frame = -1 Query: 491 SSSIGGFLSHESSFLHCCTAANCASGF----SALAAFITSSSRSVVARFLSISSS 339 SSS+ FLS SS T+++ S F S+L+ F+TSS S+++ F+S SSS Sbjct: 331 SSSLSDFLSLSSSLSDFLTSSSLPSDFLTSSSSLSDFLTSS--SLLSDFISSSSS 383 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 30.3 bits (65), Expect = 1.0 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 5/71 (7%) Frame = +1 Query: 151 ETASTDKMATDQAKNRMHVFKNAGKDVD-----EMRRRRNEVTVELRKNKREETLQKRRN 315 +TAS + ++ GKDVD E+RR+R E + +REE + RR Sbjct: 437 DTASVATEVPSMRSSDKETVRSDGKDVDDSGSLELRRQREEARRLEEQRRREEEERTRRE 496 Query: 316 VPISYSTDEEE 348 + +EEE Sbjct: 497 KEEAQRREEEE 507 >SB_20122| Best HMM Match : Arm (HMM E-Value=1.2e-24) Length = 163 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +1 Query: 433 AVQQCRKLLSCDKNPPIDELI 495 +VQ RK+LS +K+PPID++I Sbjct: 13 SVQSVRKMLSKEKSPPIDDVI 33 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/64 (26%), Positives = 33/64 (51%) Frame = +1 Query: 169 KMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEE 348 K TD + R + K+ E++R+R+E+T N R+E ++ + + +T EE Sbjct: 200 KERTDDLEQRRSSIEQNNKEYSELKRKRDELT-----NTRKELWRQEAAMEQTINTAREE 254 Query: 349 IDKN 360 + K+ Sbjct: 255 LSKS 258 >SB_57766| Best HMM Match : MFS_1 (HMM E-Value=2.4e-14) Length = 499 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -1 Query: 515 MGSIPAAMSSSIGGFLSHESSFLHCCTAANCASGFSALAAFITSSSRSVVARFLSIS 345 +GS+ A+S +G + + T CAS SA+ F+TS S+ +L+ S Sbjct: 74 VGSLALALSIGLGPVFAKLINSFGARTVTICASVVSAVGLFVTSQVNSLPLMYLTYS 130 >SB_27138| Best HMM Match : Ebp2 (HMM E-Value=1.8) Length = 841 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 337 DEEEIDKNLATTDLDELVMNAANAENPEAQLAAVQQCRKLLSCDKNPPIDELI 495 ++EE+ A L+E V+NAA N L+A++ C K + D P +++ Sbjct: 336 EDEELILQFAEYLLEERVLNAATVSN---HLSAIEYCLKYIHKDSAPVFPDVV 385 >SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 29.5 bits (63), Expect = 1.8 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 2/105 (1%) Frame = +1 Query: 184 QAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEI--DK 357 Q + ++ N D +E R+ + ++RK K+E+ +KR+ V +++ EEE+ K Sbjct: 130 QKRKKVQSKTNNKSDNEEEDERQEK---KIRKQKQEK--RKRKTVKADFNSSEEEVSSQK 184 Query: 358 NLATTDLDELVMNAANAENPEAQLAAVQQCRKLLSCDKNPPIDEL 492 A++ D+ MN A + + + S D+ + EL Sbjct: 185 TKASSRKDQKKMNKQMANKGKGAKSKKKTIESNSSDDEEGQVAEL 229 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = -3 Query: 213 LEHMHAVFRLISR--HFICARCLDTVRGNYTKKQRINIKLLSSKLIKHVLRHYTSDGGLT 40 LEH F + + + IC R LD R YT N+ L S+L+ + DG L Sbjct: 566 LEHSDCAFMVDNEAIYDICRRNLDIERPTYT-----NLNRLISQLVSSITASLRFDGALN 620 Query: 39 SIFTKYST 16 T++ T Sbjct: 621 VDLTEFQT 628 >SB_17370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1743 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -3 Query: 375 VGGSEVLVDLLLIGRIANGHITPFLKCFFSFVFS*LDCDFIPSPAHFIDIFACILE 208 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 1488 IGGTSVSLDHRMIGRITRKFFVDFL-CFRNTAILRSSCKLQYLPIHVSGFSRCLFE 1542 >SB_51370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 133 ITTYCVETASTDKMATDQAKNRMHVFKNAGKDVDEMRRR 249 I+ + ET ST + A + NR+++ K A +D +RRR Sbjct: 346 ISEHYTETVSTVQNAIKECINRLNIRKKANGFLDTLRRR 384 >SB_47670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +1 Query: 205 VFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEE 348 V+K A + R+R+E T E++K + +KRR + S +EEE Sbjct: 123 VYKLAVLSAGKKIRKRHEKTTEMQKQTKMVPRKKRRVLSSSEEEEEEE 170 >SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) Length = 434 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +1 Query: 178 TDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKRE--ETLQKRRNVPISYSTDEEEI 351 T+Q V K D +E++ R +E+ +L KNK + ET ++ + I Y +++ + Sbjct: 341 TEQIFQEKKVVKKLQVDEEEIKHRISELQNQLAKNKSKLSETQERCEKLEIRYDEEKQRL 400 >SB_45305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/65 (21%), Positives = 30/65 (46%) Frame = +1 Query: 202 HVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTDLD 381 H A + +DE R+R+++ V ++ + EE L+ N ++ + E + + + Sbjct: 238 HDKSQANRSIDEDRKRKSDELVSVKGDSEEEGLENVENTDVNGNEGPEAKKRKVIYQENS 297 Query: 382 ELVMN 396 L N Sbjct: 298 GLAQN 302 >SB_22495| Best HMM Match : DUF116 (HMM E-Value=8.1) Length = 440 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -3 Query: 375 VGGSEVLVDLLLIGRIANGHITPFLKCFFSFVFS*LDCDFIPSPAHFIDIFACILE 208 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 341 IGGTSVSLDHRMIGRITRKLFVDFL-CFRNTAILRSSCKLQYLPIHVSGFSRCLFE 395 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/90 (22%), Positives = 39/90 (43%) Frame = +1 Query: 151 ETASTDKMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISY 330 E DK DQ ++ + + K++D + + E+ E + +E + + + Sbjct: 136 EMDKEDKEEMDQEMDKEEMDQEMDKEMD--KEDKEEMDQEEMDKQDKEEMDQEMDKQDKE 193 Query: 331 STDEEEIDKNLATTDLDELVMNAANAENPE 420 D+EE+DK D+ M+ + EN E Sbjct: 194 EMDQEEMDKQDKENKEDKEEMDKQDKENKE 223 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/81 (25%), Positives = 38/81 (46%) Frame = +1 Query: 211 KNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTDLDELV 390 + A K +E R+R E +K K+EE L++++ + +E+E + L + + Sbjct: 260 EEAEKKREEEERKRREEEEAAQKWKKEELLRQQQ---LEREKEEQERAERLQREREEAME 316 Query: 391 MNAANAENPEAQLAAVQQCRK 453 E EA+ AA + RK Sbjct: 317 AEDLAEEAAEAEAAAAEAARK 337 >SB_47985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1681 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -3 Query: 135 NYTKKQRINIKLLSSKLIKHVLRHYTSDGGLTSIFTKYSTTHK 7 NY ++ + ++ L+S+ + + H D LTS Y+ HK Sbjct: 128 NYAREHKRDVTSLTSQTLHYAREHKRDDTSLTSQTLHYAREHK 170 >SB_46871| Best HMM Match : PAN (HMM E-Value=1) Length = 525 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 259 VTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTD 375 V ++ R N QK+ N+P S D E ID++L D Sbjct: 380 VRLDSRTNSSSSKRQKKTNLPKSGENDVEIIDRSLVRDD 418 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.3 bits (60), Expect = 4.1 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 166 DKMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVE-LRKNK--REETLQKRRNVPISYST 336 D + NR KN+ R RR E +V LR++K REE QKR + P S Sbjct: 329 DNSVSPPRGNRGRREKNSASP-SRRRGRREETSVSPLRRSKDSREEETQKRVDAPRDPSP 387 Query: 337 DEEE 348 EEE Sbjct: 388 MEEE 391 >SB_38184| Best HMM Match : HisKA_2 (HMM E-Value=8.6) Length = 528 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -3 Query: 375 VGGSEVLVDLLLIGRIANGHITPFLKCFFSFVFS*LDCDFIPSPAHFIDIFACILE 208 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 394 IGGTSVSLDHRMIGRITRKLFVDFL-CFRNTAILRSSCKLQYLPIHVSGFSRCLFE 448 >SB_25304| Best HMM Match : HDV_ag (HMM E-Value=0.55) Length = 2153 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/97 (20%), Positives = 41/97 (42%), Gaps = 4/97 (4%) Frame = +1 Query: 124 LCVITTYCVETASTDKMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREET-L 300 +C + +T + Q R + +N+G + + + E + R+ +RE+ L Sbjct: 1295 ICQSLEHAGKTPPALSSISQQLDTRREIQENSGTNQPQTTDKPKETRSQKRRRRREKAKL 1354 Query: 301 QKRRNVP---ISYSTDEEEIDKNLATTDLDELVMNAA 402 P I + D +E + + T++DE + AA Sbjct: 1355 YASLRTPSDDIVLANDSKEENGRVIVTEIDEAIAKAA 1391 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/86 (20%), Positives = 38/86 (44%) Frame = +1 Query: 112 DSLFLCVITTYCVETASTDKMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKRE 291 DSL + VI +T K ++ ++ K ++ ++ ++++ + +KN +E Sbjct: 1861 DSLGMAVIEKSLQKTFHPKKKENEEEDDKKEK-KEENEEEEKKKKKKENEEEDDKKNNKE 1919 Query: 292 ETLQKRRNVPISYSTDEEEIDKNLAT 369 E + + +EEE DK T Sbjct: 1920 ENEEDEKKEKKKKEENEEEDDKKKKT 1945 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 304 KRRNVPISYSTDEEEIDKNLATTDLDELVMNAANAENPEAQLAAVQQCR 450 K N+P + +T +EE L T D E +N N+ + + L A+Q + Sbjct: 19 KENNLPRTLATLQEETGITLNTVDSVESFVNEINSGHWDTVLTAIQSLK 67 >SB_27445| Best HMM Match : DUF227 (HMM E-Value=9.9) Length = 129 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -3 Query: 375 VGGSEVLVDLLLIGRIANGHITPFLKCFFSFVFS*LDCDFIPSPAHFIDIFACILE 208 +GG+ V +D +IGRI FL CF + C P H C+ E Sbjct: 5 IGGTSVSLDHRMIGRITRKLFVDFL-CFCNTAILRSSCKLQYLPIHVSVFSRCLFE 59 >SB_24364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 211 KNAGKDVDEMRRRRNEVTVELRKNKREETLQKRR 312 K+ +D DE++R+R V +R+ +R+ QKRR Sbjct: 205 KDEKEDEDELKRKR--TGVRIRRRRRQRRKQKRR 236 >SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) Length = 961 Score = 27.5 bits (58), Expect = 7.1 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +1 Query: 184 QAKNRMHV--FKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDK 357 +AK+ +V K A +D+D M R E +L K REE Q + ++ T+ E+ + Sbjct: 172 KAKDDQYVKDLKKAAEDIDLMIEREEEQVKQLTKAYREELTQ----IEKAFVTERSELIE 227 Query: 358 N 360 N Sbjct: 228 N 228 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +1 Query: 223 KDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLATTDLDEL 387 KD DEMRR ++T +LR+ + L + + S + +K T +DEL Sbjct: 1545 KDADEMRRNIIKLTTQLREADKAR-LNQGEIDDLKLSLSISQAEKQQLQTRIDEL 1598 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +1 Query: 184 QAKNRMHVFKNAGKDVDEMRRRRNEVTV--ELRKNKREETLQKRRNVPISYSTDEEEIDK 357 Q N+M K G VD+ RRR ++T E+ ++E +L+ + V ++ + +E + Sbjct: 947 QGTNKMKTLK--GVHVDKARRRAKKLTAACEVGSTRKEFSLKPDKPVSVNDTKPDEPKSR 1004 Query: 358 NLATTD 375 L D Sbjct: 1005 QLCFQD 1010 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = -3 Query: 213 LEHMHAVFRLISR--HFICARCLDTVRGNYTKKQRINIKLLSSKLIKHVLRHYTSDGGLT 40 LEH F + + + IC R LD R YT N+ L +++ V DG L Sbjct: 326 LEHSDCAFMVDNEAIYDICRRNLDIERPTYT-----NLNRLIGQIVSSVTASLRFDGALN 380 Query: 39 SIFTKYST 16 T++ T Sbjct: 381 VDLTEFQT 388 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = -3 Query: 213 LEHMHAVFRLISR--HFICARCLDTVRGNYTKKQRINIKLLSSKLIKHVLRHYTSDGGLT 40 LEH F + + + IC R LD R YT N+ L +++ + DG L Sbjct: 132 LEHSDCAFMVDNEAIYDICRRNLDIERPTYT-----NLNRLMGQIVSSITASLRFDGALN 186 Query: 39 SIFTKYST 16 T++ T Sbjct: 187 VDLTEFQT 194 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 364 ATTDLDELVMNAANAENPEAQLAAVQQCRKLLSCDKNPPIDELIAAG 504 A+T+ D LV +A PE + ++Q K ++ + PP L G Sbjct: 2114 ASTEADILVESADEGSEPEDEPQQMEQSTKTIAIGQEPPAVTLTLDG 2160 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/65 (29%), Positives = 31/65 (47%) Frame = +1 Query: 151 ETASTDKMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISY 330 ++ + +K + D+ K R K + +E RRR E E + KREE +K+R Sbjct: 420 KSETKNKDSEDEEKER----KKREAEEEEERRREEEERREEEERKREEEERKQREEEEKK 475 Query: 331 STDEE 345 +EE Sbjct: 476 REEEE 480 >SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) Length = 1178 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/96 (22%), Positives = 49/96 (51%), Gaps = 5/96 (5%) Frame = +1 Query: 106 YVDSLFLCVITTYCV---ETASTDKMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELR 276 Y D + + + + C + A+ + A + KN++ +N+G+ DEM+ + +V +L Sbjct: 862 YFDFMLISGLFSTCAGSKQQAAQAEHALEDFKNQVE--RNSGRMFDEMKTQMEKVEEDLA 919 Query: 277 KNKREETLQKRRNVPISYSTDEEEI--DKNLATTDL 378 ++K L++++ S D+ ++ DK + DL Sbjct: 920 RSK---NLREKQAKEFSRQMDDMKLKYDKQVRHPDL 952 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = -3 Query: 213 LEHMHAVFRLISR--HFICARCLDTVRGNYTKKQRINIKLLSSKLIKHVLRHYTSDGGLT 40 LEH F + + + IC R LD R YT N+ L +++ + DG L Sbjct: 259 LEHSDCAFMVDNEAIYDICRRNLDIERPTYT-----NLNRLMGQIVSSITASLRFDGALN 313 Query: 39 SIFTKYST 16 T++ T Sbjct: 314 VDLTEFQT 321 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 223 KDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDK 357 KD D + E+ + KRE+T++K+ + EEI K Sbjct: 1125 KDGDGRNKEEQELKDRMENEKREDTIRKQHRLQWEKKARAEEIAK 1169 >SB_59740| Best HMM Match : Tubulin (HMM E-Value=2.1e-25) Length = 139 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = -3 Query: 213 LEHMHAVFRLISR--HFICARCLDTVRGNYTKKQRINIKLLSSKLIKHVLRHYTSDGGLT 40 LEH F + + + IC R LD R YT N+ L +++ + DG L Sbjct: 70 LEHSDCAFMVDNEAIYDICRRNLDIERPTYT-----NLNRLMGQIVSSITASLRFDGALN 124 Query: 39 SIFTKYST 16 T++ T Sbjct: 125 VDLTEFQT 132 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = -3 Query: 213 LEHMHAVFRLISR--HFICARCLDTVRGNYTKKQRINIKLLSSKLIKHVLRHYTSDGGLT 40 LEH F + + + IC R LD R YT N+ L +++ + DG L Sbjct: 120 LEHSDCAFMVDNEAIYDICRRNLDIERPTYT-----NLNRLMGQIVSSITASLRFDGALN 174 Query: 39 SIFTKYST 16 T++ T Sbjct: 175 VDLTEFQT 182 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/87 (20%), Positives = 36/87 (41%) Frame = +1 Query: 172 MATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEI 351 + TD ++ K E ++ + E+ + K EE +KR+ S DE+E Sbjct: 1014 LVTDSVEHAEQFAKETFDKTKEGEKKMKDEQDEIERKKAEEEEKKRKEEEESKKKDEKEK 1073 Query: 352 DKNLATTDLDELVMNAANAENPEAQLA 432 ++ + +E A ++ E + A Sbjct: 1074 EEEDEDEEEEEEKKEDAKTDDSETKEA 1100 >SB_23270| Best HMM Match : Vicilin_N (HMM E-Value=4.5) Length = 143 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/78 (24%), Positives = 33/78 (42%) Frame = +1 Query: 166 DKMATDQAKNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEE 345 +K Q + R+ +G + ++R+ E R +R+ +KRR + Sbjct: 44 EKAREKQRQKRIQALVESGGEGVAKKKRKKETVAWSRNKERQIKREKRRARREFQRKQKH 103 Query: 346 EIDKNLATTDLDELVMNA 399 + D+N DLDEL A Sbjct: 104 KFDQN----DLDELASEA 117 >SB_11650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/91 (24%), Positives = 37/91 (40%), Gaps = 1/91 (1%) Frame = +1 Query: 190 KNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKREETLQKRRNVPISYSTDEEEIDKNLAT 369 K +++ N G+D R R + KNK + + I++S D+ D+ Sbjct: 86 KEHLNMATN-GRDRTGDRYHRTRSAINDSKNKIQPNNTSTNSTRITWSMDDPATDEVFRE 144 Query: 370 TDLDELVMNAANAENPEAQLA-AVQQCRKLL 459 D+DEL +A + L + C LL Sbjct: 145 LDVDELRWPEEDARDSSQDLKNKTKVCSPLL 175 >SB_4072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1364 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/56 (28%), Positives = 22/56 (39%) Frame = -3 Query: 375 VGGSEVLVDLLLIGRIANGHITPFLKCFFSFVFS*LDCDFIPSPAHFIDIFACILE 208 +GG+ V +D +IGR FL CF + C P H C+ E Sbjct: 1230 IGGTSVSLDHRMIGRTTRKFFVDFL-CFRNTAILKSSCKLPYLPIHVSGFSRCLFE 1284 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,931,996 Number of Sequences: 59808 Number of extensions: 329629 Number of successful extensions: 1261 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1235 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -