BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303D03f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 153 9e-42 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.58 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 1.8 SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) 29 3.1 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 4.1 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 4.1 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 28 5.4 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 7.1 SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) 27 7.1 SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 27 7.1 SB_7447| Best HMM Match : CHGN (HMM E-Value=0) 27 9.4 SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 27 9.4 SB_640| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 153 bits (371), Expect(2) = 9e-42 Identities = 74/111 (66%), Positives = 92/111 (82%) Frame = +1 Query: 25 IIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPK 204 I+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP+P+ Sbjct: 11 IVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVPVPQ 70 Query: 205 LKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 357 ++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 71 IRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 34.7 bits (76), Expect(2) = 9e-42 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = +1 Query: 469 HLDKNQQTTIEHKVDTF 519 HLDK QQTTI+HK++TF Sbjct: 121 HLDKTQQTTIDHKLETF 137 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 0.58 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Frame = +1 Query: 100 NSDLKAQLRELYITKAKEIE---LHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFS-- 264 + + K L+E+ I ++K+ E + + KS PKLKA Q + + KK Sbjct: 261 HEEKKEDLKEVVIKQSKQDEATAIKDSKSESKPASKPKLKAVQNDAPKKANKPAKKAKKP 320 Query: 265 ---GKHVVFVGDRKILPKPSHKTRVANKQKRPRS 357 K V+ LP+ +H+ AN Q+RP++ Sbjct: 321 VKRAKKVLNKKKMDTLPRGAHRPASANAQRRPQN 354 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.5 bits (63), Expect = 1.8 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 5/111 (4%) Frame = +1 Query: 25 IIKASGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHNKKSIIIYV 192 ++++SG +S E+ + E N+ LK +L E L +T+ +E E+ N K + +YV Sbjct: 1681 VLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-NDKLMALYV 1734 Query: 193 PMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILP-KPSHKTRVANKQ 342 M KL++ Q ELEK+ ++ ++I P K S T VA + Sbjct: 1735 NMSKLESTQGTLEEKNAELEKE------LYSAQQEIQPLKDSFNTAVAENE 1779 >SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) Length = 237 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 339 FVSNTSFVAGLRQDLTVSNKDYMFTTE 259 F+ N SFV+ + DLT S+ D+ + TE Sbjct: 40 FIPNLSFVSAVLWDLTKSSSDFQWHTE 66 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 52 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 219 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 104 PTSKPNFGSFTLQKLKKLNYTIRS 175 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 309 LRQDLTVSNKDYMFTTELLFELTDKPDLDLLKGLQFRHRHIDDDRLL 169 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 170 LRQRLNSSNPSISSPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 216 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +2 Query: 83 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 181 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 >SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 494 VVCWFLSKCTLMSCEPSNLTLMRLPTISAGKTKSSR 387 V+CW L + + + EP N L +L ++ GK K S+ Sbjct: 339 VICWVLGEYSYIVSEP-NTVLEQLHSLLDGKLKDSK 373 >SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) Length = 151 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +1 Query: 190 VPMPKLKAFQKIQIRLVRELEKKFSG 267 VP+P++ A QK++ +L R++E+K +G Sbjct: 69 VPLPQVSAMQKVKGKL-RDMEQKLNG 93 >SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/101 (19%), Positives = 49/101 (48%), Gaps = 8/101 (7%) Frame = +1 Query: 43 AEADSFETSISQALVELETNSDLKAQLRELYITKAKEI-----ELHNKKSIIIYVPMPKL 207 A+ + + Q E++T+ + K +RE ITK K + E +++++ + K+ Sbjct: 237 AQRKTLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKDELDKV 296 Query: 208 KAFQKIQIRLVRELEKKF---SGKHVVFVGDRKILPKPSHK 321 + + + +RE+E++F K+ + +R++ + K Sbjct: 297 AKLYEEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKK 337 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/99 (21%), Positives = 45/99 (45%) Frame = +1 Query: 4 VPNSARGIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSII 183 V A+ +KAS + ET S E E ++ RE+ + ++ H+++ Sbjct: 27 VTTHAKTYLKASQFRKLTRETGASVLRNERERSAKRAQAFREISPSSPQDRRKHSERRPF 86 Query: 184 IYVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKI 300 + L+ +K + +++RE+ KK + +G+ +I Sbjct: 87 LATECDNLQEAEKWRHQIIREVAKKVAQIQNAGLGEFRI 125 >SB_7447| Best HMM Match : CHGN (HMM E-Value=0) Length = 918 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +1 Query: 337 KQKRPRSRTLTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTI 498 K+KRP ++DAI F G + KLD L + D +++ T+ Sbjct: 799 KRKRPSIEKFAIIFDAITTKARFARYKNGSSKKHKLDKRPLFAMDSDSDEELTV 852 >SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 493 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 309 LRQDLTVSNKDYMFTTELLFELTDKPDLDLLKGLQFRHRHIDDDRLL 169 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 40 LRQRLNSSNPGISNPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 86 >SB_640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 289 DRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILED 396 D I+P P H+T N +K L S+ D +D Sbjct: 434 DELIIPPPRHRTETHNDEKFNVEERLRSLLDVAADD 469 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.133 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,460,842 Number of Sequences: 59808 Number of extensions: 300709 Number of successful extensions: 867 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -