BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303D03f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 268 8e-74 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.0 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.0 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 2.7 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 6.2 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 8.2 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.2 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 268 bits (657), Expect = 8e-74 Identities = 127/165 (76%), Positives = 145/165 (87%) Frame = +1 Query: 25 IIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPK 204 +IKA E D+FET I QA++ELE NSDLK QLR+LYIT+A+E+E +NKK+IIIYVP+PK Sbjct: 7 VIKAGNGEPDAFETQIGQAILELEMNSDLKPQLRDLYITRAREVEFNNKKAIIIYVPVPK 66 Query: 205 LKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDA 384 KAFQK+Q RLVRELEKKFSGKHVVF+ +R+ILPKP R NKQKRPRS +T+VYDA Sbjct: 67 QKAFQKVQTRLVRELEKKFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRSPNVTAVYDA 126 Query: 385 ILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTF 519 ILEDLVFPAE+VGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTF Sbjct: 127 ILEDLVFPAEVVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTF 171 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 2.0 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = +1 Query: 364 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTT 495 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T Sbjct: 35 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMT 75 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 2.0 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = +1 Query: 364 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTT 495 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T Sbjct: 35 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMT 75 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 2.7 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -1 Query: 446 SNLTLMRLPTISAGKTKSSRIASYTEVNVLERGLFCLLATRVLWLGLGRIL 294 +N L+ +P + T SSR + L CLLAT V+W G++L Sbjct: 54 ANSRLVTVPAPAKELTDSSRSGGLPSSSS-SSSLSCLLATIVMWC-TGQVL 102 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 6.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 261 ELLFELTDKPDLDLLKGLQFRHRHIDDDR 175 ELLFE P LDLLK + +I D+ Sbjct: 96 ELLFEGVKDPLLDLLKTINSTSLNIPFDK 124 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 152 KLNYTIRSRSSSMCR 196 + N TIRSRSSS+ R Sbjct: 271 RTNSTIRSRSSSLSR 285 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 384 SIVHRGQCP*AWPLLFVSNTSFV 316 SIVHR + PLL V+ +FV Sbjct: 1012 SIVHRQEIEDMLPLLLVATCAFV 1034 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.133 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,454 Number of Sequences: 2352 Number of extensions: 10428 Number of successful extensions: 35 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -