BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303D03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 26 0.27 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.62 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.62 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 4.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.4 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.8 bits (54), Expect = 0.27 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 Query: 52 DSFETSISQALVELETNSDLKAQLRE 129 ++ T++S AL EL N D++ +LRE Sbjct: 307 ETSSTTMSNALYELALNQDVQKKLRE 332 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.6 bits (51), Expect = 0.62 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = +1 Query: 364 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTT 495 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T Sbjct: 36 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMT 76 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.6 bits (51), Expect = 0.62 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = +1 Query: 364 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTT 495 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T Sbjct: 36 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMT 76 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 4.4 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +1 Query: 364 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTT 495 L S Y+ ++ +V + + +++KL SQLI V+L KNQ T Sbjct: 32 LLSNYNKLVRPVVNVTDAL--TVKIKLKLSQLIDVNL-KNQIMT 72 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 4.4 Identities = 16/78 (20%), Positives = 32/78 (41%) Frame = +1 Query: 157 ELHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVAN 336 EL KS + +P+P + + + +KK +G F + + + + Sbjct: 552 ELKRLKSTVSLLPLPLARTPSVMSASSTCKKDKKNAGSGSRFTIYKANKASKKKREKSSA 611 Query: 337 KQKRPRSRTLTSVYDAIL 390 K++R ++TL V L Sbjct: 612 KKERKATKTLAIVLGVFL 629 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.133 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,718 Number of Sequences: 438 Number of extensions: 2455 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -