BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303D02f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) 32 0.25 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_50003| Best HMM Match : PAN (HMM E-Value=0.044) 31 0.58 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.76 SB_10378| Best HMM Match : TSGP1 (HMM E-Value=2) 30 1.0 SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39577| Best HMM Match : DUF1213 (HMM E-Value=0.54) 30 1.3 SB_28308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_12695| Best HMM Match : Linker_histone (HMM E-Value=1.6e-38) 29 1.8 SB_44588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_20227| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_17373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_59003| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11561| Best HMM Match : HAT (HMM E-Value=1.1) 29 3.1 SB_9272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_48636| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38092| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_20452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) 28 4.1 SB_14622| Best HMM Match : DUF1441 (HMM E-Value=1.6) 28 4.1 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_9915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48509| Best HMM Match : DUF352 (HMM E-Value=2.4) 28 5.4 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 28 5.4 SB_24870| Best HMM Match : zf-GRF (HMM E-Value=0.019) 28 5.4 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 27 7.1 SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_27838| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_13913| Best HMM Match : WH2 (HMM E-Value=8.8e-05) 27 7.1 SB_59772| Best HMM Match : dDENN (HMM E-Value=1.6e-24) 27 7.1 SB_57248| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_55276| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) 27 7.1 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) 27 9.4 SB_45626| Best HMM Match : Equine_IAV_S2 (HMM E-Value=6.6) 27 9.4 SB_41056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_33019| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_21253| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) 27 9.4 SB_15672| Best HMM Match : DUF1556 (HMM E-Value=8.9) 27 9.4 SB_11732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_10582| Best HMM Match : DUF1168 (HMM E-Value=1.8) 27 9.4 SB_49819| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_24123| Best HMM Match : RCSD (HMM E-Value=3.8) 27 9.4 SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11) 27 9.4 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 27 9.4 SB_5549| Best HMM Match : PT (HMM E-Value=1.9) 27 9.4 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 35.5 bits (78), Expect = 0.027 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 259 PPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQDNKSG 423 PPR+ PK TP+KP + ++ S ++KA E +D G+++ K G Sbjct: 1167 PPRKKPKNKGNKSPSTPSKPAMSARRDSEENIEKALEAG--LDQFGVEVLQEKEG 1219 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 33.1 bits (72), Expect = 0.14 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 4/64 (6%) Frame = +1 Query: 250 NTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATER----NDKVDSVGIQMQDNK 417 ++SPP+ T ++ P KPPS K K PI K R N+ D G+ + Sbjct: 1510 SSSPPKPVKPSTKPVVPVKPVKPPSPIKPKPPIPSSKPARRGSGSNNNSDDAGVGIYSEA 1569 Query: 418 SGHR 429 S R Sbjct: 1570 SPTR 1573 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 32.7 bits (71), Expect = 0.19 Identities = 18/73 (24%), Positives = 33/73 (45%) Frame = +1 Query: 235 VDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQDN 414 +D+ ++ S + PKKTP L + +KP ++ K + + TE N K+ N Sbjct: 590 IDEGLDFSSKQTKPKKTPIFLQGSIDKPKPPEEPKKKNENELLTENNRKMSGASSTRSKN 649 Query: 415 KSGHRIGMRLRNL 453 + ++NL Sbjct: 650 SVSYDFKESVQNL 662 >SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23) Length = 565 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 256 SPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERND 378 SP QS TPK+ ++ ++PPS ++SP + TE+ + Sbjct: 525 SPKSQSRPSTPKVGSRPSSRPPSGSPRQSPQPSIETTEQTE 565 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 32.3 bits (70), Expect = 0.25 Identities = 27/79 (34%), Positives = 38/79 (48%) Frame = +1 Query: 142 LPPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPP 321 LPP P P PV IR + +F DDF + + + K K+ +K +K Sbjct: 899 LPPAPPP--PVDHAL---FDTSIRPPS--LFSDDFEDVTRVKPKTKSELKVKSKPAHK-- 949 Query: 322 SAKKQKSPIKVQKATERND 378 S KKQ SPIK+ A + N+ Sbjct: 950 SHKKQTSPIKMFSADDANN 968 >SB_50003| Best HMM Match : PAN (HMM E-Value=0.044) Length = 286 Score = 31.1 bits (67), Expect = 0.58 Identities = 20/82 (24%), Positives = 36/82 (43%) Frame = +1 Query: 139 KLPPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKP 318 +LPP P P+ +K P ++ + + V ++PP+Q P+ T +T Sbjct: 55 QLPPAPQPTANPEKAEE---PQPLKPLDNYTSAAAAVPSTPPKQDPRST-VAFGRTTKSS 110 Query: 319 PSAKKQKSPIKVQKATERNDKV 384 P K V++ + ND+V Sbjct: 111 PVQKSPSRVGHVRRYSLENDQV 132 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 30.7 bits (66), Expect = 0.76 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 157 APSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPS-AKK 333 AP +K + + + + K++ + D + S P PK + N P K AKK Sbjct: 258 APHHEEKKEDLKEVVIKQSKQDEATAIKDSKSESKPASKPK-LKAVQNDAPKKANKPAKK 316 Query: 334 QKSPIKVQKATERNDKVDSV 393 K P+K K K+D++ Sbjct: 317 AKKPVKRAKKVLNKKKMDTL 336 >SB_10378| Best HMM Match : TSGP1 (HMM E-Value=2) Length = 114 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +1 Query: 259 PPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATE-RNDKVDSVGIQMQDNKSGHR 429 P Q K P K P KP KK K P K +K + R K G ++ + GH+ Sbjct: 51 PATQYGKWRPYESKKKPKKPRKPKKPKKPRKPKKPKKPRKPKKPKKGKWRKNKQGGHK 108 >SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1101 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +1 Query: 259 PPRQSPKKTPKILNKTPNKPPSAKKQK-SPIKVQKATERNDKVDSVGIQMQDNKSGHRIG 435 P + SP P +TP PP + K + +K+ E+ND + S + + GH Sbjct: 903 PQQPSPSPEPAAPTETPESPPDGEGDKGGEGESEKSKEKNDDLTS-----KMHVLGHDEN 957 Query: 436 MRLRNLLKLP 465 +R ++L LP Sbjct: 958 IRTKSLEHLP 967 >SB_39577| Best HMM Match : DUF1213 (HMM E-Value=0.54) Length = 240 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 262 PRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATER 372 P+ SPK +PK KT +K QK+ + + T R Sbjct: 138 PKTSPKSSPKTSPKTSSKTSLKTSQKTSLNASRKTSR 174 >SB_28308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 298 NKTPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQ-DNKSGHRIGMRLRNLLK 459 + T PP+AK+QK A E D ++++G Q ++ I RL +++K Sbjct: 159 DNTSTGPPAAKRQKGDDSQNSACEEQDILNNLGKQYSTTDQESPEINARLADIVK 213 >SB_12695| Best HMM Match : Linker_histone (HMM E-Value=1.6e-38) Length = 184 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +1 Query: 247 VNTSPPRQSPK---KTPKILNKTPNKPPSAKKQKSPIK--VQKATERNDK 381 V P+++ K K PK K K P+AKK KSP K +KAT+ K Sbjct: 91 VKAEKPKKAKKPAAKKPKAAKKPAAKKPAAKKAKSPKKSAPKKATKSPKK 140 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 256 SPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATER 372 SP + +PKK K KT KP A K+ + K +KA + Sbjct: 125 SPKKSAPKKATKSPKKTAKKP--AAKKPAAAKPKKAAAK 161 >SB_44588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +1 Query: 247 VNTSPPRQSPK---KTPKILNKTPNKPPSAKKQKSPIK--VQKATERNDK 381 V P+++ K K PK K K P+AKK KSP K +KAT+ K Sbjct: 91 VKAEKPKKAKKPAAKKPKAAKKPAAKKPAAKKAKSPKKPAPKKATKSPKK 140 >SB_20227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/95 (21%), Positives = 42/95 (44%) Frame = +1 Query: 184 NARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKA 363 N R P IR +N + TS P+ K +P + P +PP+ KK++ P++V + Sbjct: 98 NNRVSPETIRDENHNNRALPKLITSDPKVKLKPSPPPV--AP-RPPNTKKKEQPVRVSTS 154 Query: 364 TERNDKVDSVGIQMQDNKSGHRIGMRLRNLLKLPK 468 +++ + I ++ + ++ P+ Sbjct: 155 ESPSEEDSGISIDVRARMELDSVNSESNEVIATPR 189 >SB_17373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +1 Query: 247 VNTSPPRQSPK---KTPKILNKTPNKPPSAKKQKSPIK--VQKATERNDK 381 V P+++ K K PK K K P+AKK KSP K +KAT+ K Sbjct: 154 VKAEKPKKAKKPAAKKPKAAKKPAAKKPAAKKAKSPKKPAPKKATKSPKK 203 >SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 6/91 (6%) Frame = +1 Query: 142 LPPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNK-- 315 + P P+ PV++ P NR +T+P P++ K N +P++ Sbjct: 318 ISPVTTPTAPVEREEGSRSPDHALCSNRSPVSSPLAHTTPTSTVPREHLK--NASPSQIV 375 Query: 316 ----PPSAKKQKSPIKVQKATERNDKVDSVG 396 P AK+ SP+ +R+ V SVG Sbjct: 376 ESGSSPHAKEPVSPVHDVPTEDRHSPVKSVG 406 >SB_59003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +1 Query: 136 TKLPPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNK 315 T LP P ++ + G ++ ++ + + + PR S ++TP+ +TP Sbjct: 409 TPLPTTPRSGSQAERTTSSGSSDKLSRRRGLLTL----TLAVPRSSSQRTPRSAQRTPRS 464 Query: 316 PPSAKK-QKSPIKVQK 360 SA++ +S VQ+ Sbjct: 465 GSSAQRTPRSGSSVQR 480 >SB_11561| Best HMM Match : HAT (HMM E-Value=1.1) Length = 409 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 238 DDFVNTSPPRQSPKKTPKILNK-TPNKPPSAKKQKSPIKVQKATER 372 D V P + +PK TPK+ K TP P + +P K T + Sbjct: 36 DQSVGPEPSKVTPKVTPKVTPKVTPKVTPKVTPKVTPKVTPKVTPK 81 >SB_9272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +1 Query: 265 RQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQDNKSGHR 429 +QSP+ +PK K+ KP + K +SP + + +D+ D + +D + R Sbjct: 41 QQSPRASPKATRKSTPKPRTPSKGRSPSR-KLIGFSSDEEDGDSVSTRDRRGSIR 94 >SB_48636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +1 Query: 247 VNTSPPRQSPK---KTPKILNKTPNKPPSAKKQKSPIK 351 V P+++ K K PK K K P+AKK KSP K Sbjct: 90 VKAEKPKKAKKPAAKKPKAAKKPAAKKPAAKKAKSPKK 127 >SB_38092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/74 (22%), Positives = 33/74 (44%) Frame = +1 Query: 211 RKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERNDKVDS 390 R+KN+ +D + P + + + +L KTP+ + KSP + K R Sbjct: 1 RRKNKMSGLDRSIPEVPAKPDQRPSSAVLTKTPSDHEHKETPKSPGPLSKRWFR----QQ 56 Query: 391 VGIQMQDNKSGHRI 432 GI+ +D + ++ Sbjct: 57 FGIRNEDTRKASKV 70 >SB_20452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/54 (24%), Positives = 27/54 (50%) Frame = +1 Query: 247 VNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQ 408 VN++ PR++ +KT + K K +KK+ I + E + + S ++ + Sbjct: 761 VNSASPRKNTRKTKSLRKKASLKELKSKKENCDIVSKLTPEMRNDLSSASVESE 814 >SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 214 KKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSP 345 K N D+ PPRQS PKI + P+A + ++P Sbjct: 220 KVNFSCVFDNVTGVEPPRQSSTPQPKITGTSQPSNPTATQPQNP 263 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/110 (16%), Positives = 47/110 (42%) Frame = +1 Query: 145 PPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPS 324 PP +P+Q+L + + +++ ++ + P K + + P + P+ Sbjct: 2604 PPSIGKQQPLQQLQEKQLQDQLQMQHMQKQTTQQLMQGPMMHLAGKQQQPPAQLPQQQPT 2663 Query: 325 AKKQKSPIKVQKATERNDKVDSVGIQMQDNKSGHRIGMRLRNLLKLPKAH 474 K++ P+ + + + + +Q Q+NKS + ++ + K+H Sbjct: 2664 QVKKQQPLPIAPSAGAHHQNKPPRLQAQENKSKQQSQVKQEGKKEENKSH 2713 >SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) Length = 409 Score = 28.3 bits (60), Expect = 4.1 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 14/77 (18%) Frame = +1 Query: 145 PPKPAPSEPVQ-----KLNARGMPARIRKKNRFIFVDDFVNT---------SPPRQSPKK 282 PP+P SEP+Q + P + ++ D+F +T SPP KK Sbjct: 256 PPRPPKSEPIQGETYDLVQEAAPPVALASQSEAALGDEFYDTAEEETESKPSPPPPGEKK 315 Query: 283 TPKILNKTPNKPPSAKK 333 P L P+ PP+ K Sbjct: 316 AP--LPTPPSTPPAVTK 330 >SB_14622| Best HMM Match : DUF1441 (HMM E-Value=1.6) Length = 426 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -3 Query: 441 SHANSMT*FIVLHLDAYRIYLIIPLCSLLNFYWRFLFFCTWWFIR 307 S S+ F+ +DAYR+Y ++P +F+ + T W++R Sbjct: 75 SFTQSLVQFVHQEMDAYRLYTVVPRLV------KFIEYLTNWYVR 113 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 256 SPPRQ---SPKKTPKILNKTPNKPPSAKKQKSPIKVQKATER 372 SPPR+ SP +P + +P PP K+ +P ++A + Sbjct: 929 SPPRRRRRSPSNSPPPMRSSPLPPPQRKRASTPPSPRRARRK 970 >SB_9915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 190 RGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQ 357 R P+R K+NR + D V +P P +T P S+K +K+P+ Q Sbjct: 18 RSSPSRRHKRNRSLKNRDEVFATP----PSSVTLAFTRTRGTPSSSKLRKTPVLTQ 69 >SB_48509| Best HMM Match : DUF352 (HMM E-Value=2.4) Length = 268 Score = 27.9 bits (59), Expect = 5.4 Identities = 21/87 (24%), Positives = 41/87 (47%) Frame = +1 Query: 178 KLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQ 357 KL + P + ++N+ FV V TS R+ K +PK + + PP Q+ PI+ + Sbjct: 143 KLAVQNRPQQSEEENK-TFVTQQV-TSKKRKGRKASPKNPETSTSLPPLTMSQEEPIERR 200 Query: 358 KATERNDKVDSVGIQMQDNKSGHRIGM 438 + K S ++ ++ ++G+ Sbjct: 201 LKRKHLSKQLSFPEMLKVSREMSKVGL 227 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +1 Query: 253 TSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQK 360 T PP P+ TPK P PP + P + K Sbjct: 137 TPPPPTPPQSTPKPRRVLPTPPPKPPTPRPPRRASK 172 >SB_24870| Best HMM Match : zf-GRF (HMM E-Value=0.019) Length = 197 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 244 FVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKAT 366 FV P+ S +K P + PPS KK+K+P + +K T Sbjct: 98 FVWAEEPKDSERKKPAAVWT----PPSMKKKKAPARARKQT 134 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 27.5 bits (58), Expect = 7.1 Identities = 22/96 (22%), Positives = 37/96 (38%), Gaps = 5/96 (5%) Frame = +1 Query: 148 PKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKT-----PKILNKTPN 312 P P PSE Q + P + + + + +PP ++ K T P I K P Sbjct: 307 PPPQPSEEKQDIPLPSKPTAGARDMKKVLPKELKKPAPPPENSKPTIDAPKPSIPPKKPV 366 Query: 313 KPPSAKKQKSPIKVQKATERNDKVDSVGIQMQDNKS 420 P + K + K + + +S I M + K+ Sbjct: 367 PPKPSTKPQIHKKAVPIPPVDHRKESPKISMTEEKA 402 >SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/61 (34%), Positives = 25/61 (40%) Frame = +1 Query: 178 KLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQ 357 KLN + A KK + T P + K TP K+P KP K KSP K Sbjct: 207 KLNKAAVKAEKPKKAKKPAAKKPKATKKP--AAKTTPSNKAKSPKKPAPKKATKSPKKAA 264 Query: 358 K 360 K Sbjct: 265 K 265 >SB_27838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +1 Query: 196 MPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQK 360 MP + + ++ + +T +K K + K NK P KKQK P KVQK Sbjct: 1 MPDKRPQLTAYLAEYERTHTQMDAYKKRKHAKRIKKHRNKIP--KKQKKPTKVQK 53 >SB_13913| Best HMM Match : WH2 (HMM E-Value=8.8e-05) Length = 493 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 4/57 (7%) Frame = +1 Query: 256 SPPRQSPKKTPKILNK--TPNKPPSAKKQ-KSP-IKVQKATERNDKVDSVGIQMQDN 414 +PP++SPKK+PK + + + P AK++ +SP + K + R V S +++N Sbjct: 45 APPKKSPKKSPKSPKRRSSDSGPLKAKQEGQSPKDPIPKGSPRTPPVTSKRRSLKEN 101 >SB_59772| Best HMM Match : dDENN (HMM E-Value=1.6e-24) Length = 423 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +1 Query: 304 TPNKPPSAKKQKSPIKVQKATERNDKVDSV 393 +P P AKKQKSP K TER +K V Sbjct: 161 SPKLKPRAKKQKSPSSSPK-TERREKPSRV 189 >SB_57248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 256 SPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKA-TERNDKVDSVG 396 +PP KT I+ NKP K++KS IK K T+ +D+ + G Sbjct: 188 TPPNFHEDKTGGIVTTKKNKPKYRKEEKSNIKGFKTDTQISDRKVNTG 235 >SB_55276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 27.5 bits (58), Expect = 7.1 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 5/99 (5%) Frame = +1 Query: 139 KLPPKPAPSEPVQKLNARGMPARIRK-----KNRFIFVDDFVNTSPPRQSPKKTPKILNK 303 +LPP P E A G ++ RK K+RF +DD+ ++ P Q ++ ++ Sbjct: 221 RLPPLQIPREHEDSSKA-GFDSKTRKERGPRKSRFEPLDDYGDSRDPNQGSRERSELREG 279 Query: 304 TPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQDNKS 420 + PS + ++ ++R DK + + +N++ Sbjct: 280 QSSYRPSHRLEEREEYPALYSDRYDKTNHYEDRKTNNET 318 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/84 (23%), Positives = 32/84 (38%), Gaps = 1/84 (1%) Frame = +1 Query: 145 PPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPPS 324 PP P P EP +++ P + K + I + F++ P P P P Sbjct: 945 PPSPPPKEPTPPPSSKPSPVKEIKPKKPI--EKFISRPKPPTPPPVVSPHKQTRPISPVG 1002 Query: 325 AKKQKSPI-KVQKATERNDKVDSV 393 A P+ +T + K DS+ Sbjct: 1003 ASNLYKPLTPTSPSTLQPSKQDSL 1026 >SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) Length = 692 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 158 LQVSQFKNLMQGECPLGSERKIGSFLLTIL*TRHLHDSLQKRLQKYL 298 L V F++ L + K G LL ++ +LH S++KRLQ +L Sbjct: 158 LTVGIFRSPSPERGRLSEKSKRGIRLLCVVRNTNLHPSIRKRLQNWL 204 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 7.1 Identities = 23/73 (31%), Positives = 27/73 (36%), Gaps = 1/73 (1%) Frame = +1 Query: 133 GTKLPPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPN 312 G + P P P +P + G P N I D NT P P TP N PN Sbjct: 41 GDRPPNTPIPGDPPPNIPIPGNPP----PNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPN 96 Query: 313 KP-PSAKKQKSPI 348 P P +PI Sbjct: 97 TPIPGDPPPNTPI 109 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 259 PPRQSPKKTPKILNKTPNKPPSAKKQKSP 345 PP +P P N TP PP K P Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPP 377 >SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) Length = 943 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 214 KKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPP 321 K +R++ + + PR SP + ++ + PN+PP Sbjct: 885 KCSRYVLITEKPGKKGPRASPLEQSLLMARFPNQPP 920 >SB_45626| Best HMM Match : Equine_IAV_S2 (HMM E-Value=6.6) Length = 315 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 271 SPKKTPKILNKTPNKPPSAKKQKSPIKVQK 360 S + +P IL K PNK + K +K KVQ+ Sbjct: 21 SQRSSPVILTKHPNKHNTGKGRKGEEKVQE 50 >SB_41056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 265 RQSPKKTPKILNKTPNKPPSAKKQKSPIKVQK 360 + + K TP K+P KP K KSP K K Sbjct: 148 KPAAKTTPSKKAKSPKKPAPKKATKSPKKAAK 179 >SB_33019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 241 DFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERND 378 + + R S TP++ P P ++++KSP +V+K T ++ Sbjct: 462 ELMKAKESRASGNNTPEMKRGKPRTPEKSRRRKSP-EVRKRTNESE 506 >SB_21253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 139 KLPPKPAPSEPVQKLNARGMPARIRKK 219 ++P P+EP+ L +PARIR++ Sbjct: 82 EIPATQGPNEPITDLGPSTLPARIRQE 108 >SB_15716| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/67 (22%), Positives = 28/67 (41%) Frame = +1 Query: 268 QSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQDNKSGHRIGMRLR 447 Q P LN+TP + + + + D + + M+ S +G+ +R Sbjct: 282 QKPVVNEMPLNQTPRSSTATSRHSASPDMDDVAFSPDGATNNDVAMETEPSHLSMGVSIR 341 Query: 448 NLLKLPK 468 NL+KL + Sbjct: 342 NLVKLSR 348 >SB_15672| Best HMM Match : DUF1556 (HMM E-Value=8.9) Length = 192 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 214 KKNRFIFVDDFVNTSPPRQSPKKTPKILNKTPNKPP 321 K +R++ + + PR SP + ++ + PN+PP Sbjct: 134 KCSRYVLITEKPGKKGPRASPLEQSLLMARFPNQPP 169 >SB_11732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 196 MPARIRKKNRFI---FVDDFVNTSPPRQSPKKTPKILNKTPNKPPS 324 +PA RK+ + FVD + P R S K+ P + T ++PPS Sbjct: 859 IPAEERKEIKMELEKFVDSLADEPPMRVSLKEFPDTPDSTTHRPPS 904 >SB_10582| Best HMM Match : DUF1168 (HMM E-Value=1.8) Length = 454 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/57 (28%), Positives = 24/57 (42%) Frame = +1 Query: 250 NTSPPRQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATERNDKVDSVGIQMQDNKS 420 NTS P + P+ T + N + PP + K + + DKVD Q + S Sbjct: 127 NTSLPNE-PQSTEVVKNTVGDPPPPVAPPRRKRKKKSPGQVEDKVDGPAASTQQDPS 182 >SB_49819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 663 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -3 Query: 267 SWR*RVH--KIVN-KNEPIFLSDPSGHSPCIKFLNWLTWSW 154 +W+ H KI N K E S + HSP + L WL W + Sbjct: 412 NWKNLCHRLKIPNSKYESFDASKKNAHSPTKQMLRWLKWKY 452 >SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 27.1 bits (57), Expect = 9.4 Identities = 23/73 (31%), Positives = 35/73 (47%) Frame = +1 Query: 127 RVGTKLPPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKT 306 ++ L PAP + + R + +R +R +NTS ++P KTPK NKT Sbjct: 15 KLDAPLAKGPAPRWQRKASSGRSQTSPLRNSSR-------LNTST--KTPTKTPKSSNKT 65 Query: 307 PNKPPSAKKQKSP 345 P +AK K+P Sbjct: 66 ---PLTAKTPKTP 75 >SB_24123| Best HMM Match : RCSD (HMM E-Value=3.8) Length = 255 Score = 27.1 bits (57), Expect = 9.4 Identities = 23/73 (31%), Positives = 35/73 (47%) Frame = +1 Query: 127 RVGTKLPPKPAPSEPVQKLNARGMPARIRKKNRFIFVDDFVNTSPPRQSPKKTPKILNKT 306 ++ L PAP + + R + +R +R +NTS ++P KTPK NKT Sbjct: 15 KLDAPLAKGPAPRWQRKASSGRSQTSPLRNSSR-------LNTST--KTPTKTPKSSNKT 65 Query: 307 PNKPPSAKKQKSP 345 P +AK K+P Sbjct: 66 ---PLTAKTPKTP 75 >SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11) Length = 2297 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 235 VDDFVNTSPPRQSPKKTPKILNKTPNKPPSAKKQ 336 VDD VN + P+ PK P+ P +P A++Q Sbjct: 1892 VDDKVNKTQPQAQPKPRPR--TNRPAQPVPARRQ 1923 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 265 RQSPKKTPKILNKTPNKPPSAKKQKSPIKVQK 360 + + K TP K+P KP K KSP K K Sbjct: 308 KPAAKTTPSKKAKSPKKPAPKKATKSPKKAAK 339 >SB_5549| Best HMM Match : PT (HMM E-Value=1.9) Length = 282 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +1 Query: 247 VNTSPP---RQSPKKTPKILNKTPNKPPSAKKQKSPIKVQKATER 372 + TSP ++SPK TPK KT K +K+ + + T R Sbjct: 25 LKTSPKTRRKKSPKTTPKTSLKTSRKTSLKTSRKTSLNASRKTSR 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.132 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,400,306 Number of Sequences: 59808 Number of extensions: 309631 Number of successful extensions: 1037 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1022 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -