Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS303D01f
         (382 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    27   0.063
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    22   2.4  

>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 27.1 bits (57), Expect = 0.063
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = -3

Query: 206 IYLCGTTMSSKNCAKHRTACSNAASSIDRDKLSNF 102
           IYLCG  M  +N  +  T   N +   D++KL +F
Sbjct: 244 IYLCGRVMEEQNKIRLITFEMNKSFERDKNKLGDF 278


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.8 bits (44), Expect = 2.4
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +2

Query: 215 VFFICHFWCS 244
           VF+ICH  CS
Sbjct: 646 VFYICHVCCS 655


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 69,346
Number of Sequences: 336
Number of extensions: 936
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  7908675
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)