BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303C12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 2.7 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 2.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.2 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 8.2 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.2 bits (50), Expect = 2.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 182 RTSFSYLAGWKNHCS 226 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.2 bits (50), Expect = 2.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 182 RTSFSYLAGWKNHCS 226 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 6.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 372 FITLWENNRVYFKIHNTKYNQYLKMSTTTCNCNSRDR 262 FI+ W+ VY+ +H YN+ +S T S R Sbjct: 392 FISHWQEEGVYWSLHYL-YNRLRDISEETSALPSHPR 427 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/29 (34%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = -3 Query: 255 YGGNSADSTR-EQWFFQPAKYENDVLFFI 172 YG + R E WF Q A DV+ + Sbjct: 246 YGSKEINDFRSEDWFIQAASSPKDVIILL 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,645 Number of Sequences: 2352 Number of extensions: 10266 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -