BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303C12f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical pr... 28 4.7 AF101319-3|AAC69355.1| 331|Caenorhabditis elegans Hypothetical ... 28 4.7 >Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical protein C29E6.1a protein. Length = 812 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 158 STMPWSSVRS*TPRETARPLDTMVKSPVFLTST 60 ST ++ + TP+ + +P T KSPV +T+T Sbjct: 388 STKKLTTTTTTTPKPSQKPTTTTTKSPVVITTT 420 >AF101319-3|AAC69355.1| 331|Caenorhabditis elegans Hypothetical protein K08D9.5 protein. Length = 331 Score = 27.9 bits (59), Expect = 4.7 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = -3 Query: 498 LFKIIYRNYNLALKLGSTTNPSNERIAYGDGVD-KHTELVSWKFITLWENNRVYFKIHNT 322 + KII Y++ S NE A + +D HT + + +FIT ++N V F ++ Sbjct: 60 MIKIIQNEYSI----DSLLETDNETSALIETLDVSHTFIEAAEFITFLDSNDVLFPVNYP 115 Query: 321 KYNQ 310 Y Q Sbjct: 116 TYTQ 119 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,634,166 Number of Sequences: 27780 Number of extensions: 200386 Number of successful extensions: 796 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -