BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303C09f (492 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.90 SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023) 30 0.90 SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) 30 1.2 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 30 1.2 SB_41747| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 29 1.6 SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) 29 1.6 SB_57876| Best HMM Match : SH3_1 (HMM E-Value=0.15) 29 2.8 SB_57797| Best HMM Match : rve (HMM E-Value=6.9e-21) 29 2.8 SB_56243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_55060| Best HMM Match : rve (HMM E-Value=0.0085) 29 2.8 SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) 29 2.8 SB_46885| Best HMM Match : SH3_1 (HMM E-Value=0.021) 29 2.8 SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_35655| Best HMM Match : SH3_1 (HMM E-Value=0.97) 29 2.8 SB_32358| Best HMM Match : SH3_1 (HMM E-Value=0.97) 29 2.8 SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) 29 2.8 SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 29 2.8 SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_21329| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_15802| Best HMM Match : rve (HMM E-Value=6.9e-21) 29 2.8 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 29 2.8 SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17) 29 2.8 SB_27233| Best HMM Match : SH3_1 (HMM E-Value=0.18) 29 2.8 SB_14016| Best HMM Match : rve (HMM E-Value=0.0027) 29 2.8 SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21) 29 2.8 SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) 29 2.8 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_2735| Best HMM Match : SH3_1 (HMM E-Value=0.97) 29 2.8 SB_36143| Best HMM Match : SH3_1 (HMM E-Value=0.18) 28 3.6 SB_47102| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_52607| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_6199| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_32020| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) 27 8.4 SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 30.3 bits (65), Expect = 0.90 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 358 NEVVRQRTKVIGIAQRVSKLKWQWAGH 278 NE + QRTK + Q V + +W+W GH Sbjct: 496 NEELWQRTKQQPVDQNVLQRRWRWIGH 522 >SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023) Length = 423 Score = 30.3 bits (65), Expect = 0.90 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 358 NEVVRQRTKVIGIAQRVSKLKWQWAGH 278 NE + QRTK + Q V + +W+W GH Sbjct: 382 NEELWQRTKQQPVDQNVLQRRWRWIGH 408 >SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) Length = 1266 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 160 SPVYGSPHPLLAGYRSEVIAPPSQGATHVTSSAARXPLVYGQPT 291 +PV G PH + + + P + VT++ AR P V G PT Sbjct: 1074 NPVTGRPHQAVQQPLPQQLPPQYRPPAIVTAAVARPPQVQGPPT 1117 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P L ++++ PPS Sbjct: 1161 DTPMNPKMPVAPTYMSPQPQLVARKAQINEPPS 1193 >SB_41747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P L ++++ PPS Sbjct: 570 DTPMNPKMPVAPTYMSPQPQLVARKAQINEPPS 602 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 358 NEVVRQRTKVIGIAQRVSKLKWQWAGH 278 NE + QRTK + Q V + +W+W GH Sbjct: 391 NEELWQRTKQQPVDQDVLQRRWRWIGH 417 >SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) Length = 585 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 358 NEVVRQRTKVIGIAQRVSKLKWQWAGH 278 NE + QRTK + Q V + +W+W GH Sbjct: 449 NEELWQRTKQQPVDQDVLQRRWRWIGH 475 >SB_57876| Best HMM Match : SH3_1 (HMM E-Value=0.15) Length = 216 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 149 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 181 >SB_57797| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 368 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 301 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 333 >SB_56243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 62 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 94 >SB_55060| Best HMM Match : rve (HMM E-Value=0.0085) Length = 277 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 210 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 242 >SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) Length = 1329 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 1262 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 1294 >SB_46885| Best HMM Match : SH3_1 (HMM E-Value=0.021) Length = 235 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 168 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 200 >SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 703 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 735 >SB_35655| Best HMM Match : SH3_1 (HMM E-Value=0.97) Length = 129 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 62 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 94 >SB_32358| Best HMM Match : SH3_1 (HMM E-Value=0.97) Length = 129 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 62 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 94 >SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 1183 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 1116 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 1148 >SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +3 Query: 129 GH-RPLPIHTTEPGLRLS-SSTSCRLPFGGH 215 GH RP P+ +TEP +R++ ST R+ G H Sbjct: 742 GHTRPYPVFSTEPYIRVTLQSTESRIVSGNH 772 >SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1197 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 1130 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 1162 >SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 358 NEVVRQRTKVIGIAQRVSKLKWQWAGH 278 NE + QRTK + Q V +W+W GH Sbjct: 172 NEELWQRTKQQPVDQDVLHRRWRWIGH 198 >SB_21329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 35 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 67 >SB_15802| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 481 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 414 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 446 >SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) Length = 1641 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 358 NEVVRQRTKVIGIAQRVSKLKWQWAGH 278 NE + QRTK + Q V +W+W GH Sbjct: 146 NEELWQRTKQQPVDQDVLHRRWRWIGH 172 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 358 NEVVRQRTKVIGIAQRVSKLKWQWAGH 278 NE + QRTK + Q V +W+W GH Sbjct: 506 NEELWQRTKQQPVDQDVLHRRWRWIGH 532 >SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17) Length = 414 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 347 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 379 >SB_27233| Best HMM Match : SH3_1 (HMM E-Value=0.18) Length = 241 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 175 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 207 >SB_14016| Best HMM Match : rve (HMM E-Value=0.0027) Length = 430 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 363 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 395 >SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 428 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 361 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 393 >SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) Length = 1311 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 1244 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 1276 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 129 GHRP--LPIHTTEPGLRLSSSTSCRLPFGG 212 G+RP LP+ T GL + +TSC FGG Sbjct: 463 GYRPEKLPLRRTPDGLAILDNTSCGPVFGG 492 >SB_2735| Best HMM Match : SH3_1 (HMM E-Value=0.97) Length = 129 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 62 DTPMNPKMPVAPTYMSPQPQVVARKAQINEPPS 94 >SB_36143| Best HMM Match : SH3_1 (HMM E-Value=0.18) Length = 167 Score = 28.3 bits (60), Expect = 3.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 130 DIGLSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 D ++ P++P Y SP P + ++++ PPS Sbjct: 100 DTPMNLKMPVAPTYMSPQPQVVARKAQINEPPS 132 >SB_47102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 275 YMASPLPLQLADSLSYPDDFSSLSN 349 Y+A+ P Q SL YPDD+S++ + Sbjct: 28 YLANQHPSQHVISLDYPDDYSTIKD 52 >SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2051 Score = 27.9 bits (59), Expect = 4.8 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -2 Query: 326 RDSSKS--QQAEVAVGWPYTSGXRAAEDVTWVAPWLGGAMTSE 204 +DSS + ++ +VA P AAE V W+AP LG +TS+ Sbjct: 1299 KDSSIAVDEKEKVADLTPAYVSAMAAESVMWLAPRLGPVLTSQ 1341 >SB_52607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 139 LSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 ++ P++P Y SP P + ++++ PPS Sbjct: 1 MNPKMPVAPTYMSPQPQVVARKAQINEPPS 30 >SB_6199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 139 LSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 ++ P++P Y SP P + ++++ PPS Sbjct: 1 MNPKMPVAPTYMSPQPQVVARKAQINEPPS 30 >SB_32020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 139 LSQSTPLSPVYGSPHPLLAGYRSEVIAPPS 228 ++ P++P Y SP P + ++++ PPS Sbjct: 1 MNPKMPVAPTYMSPQPQVVARKAQINEPPS 30 >SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) Length = 1148 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 219 CDDLRTVAGKKWMRRAVDRAQWCGLGEAYVQQWTTVG 109 C L+ V GK+W+RR V + G G+ Q+ T G Sbjct: 1006 CSGLKGVLGKEWLRRTVSGS---GSGQREPQRRTVSG 1039 >SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 193 AGYRSEVIAPPSQGATHVTSSAAR 264 +G RSEV+ QGA H SA R Sbjct: 678 SGLRSEVVGELGQGAKHCAESAVR 701 >SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1144 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 142 SQSTPLSPVYGSPHPLLAGYRSEVIAPPSQGATH-VTSSAARXPLVYGQPTAT 297 S+ L P + HP+ + I PP Q A+H V + + P++ Q A+ Sbjct: 827 SEKRGLPPQQPASHPVFGTTSEQPILPPQQPASHPVFGTTSEQPILPPQQPAS 879 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,959,347 Number of Sequences: 59808 Number of extensions: 274850 Number of successful extensions: 701 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -