BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303C05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 4e-08 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 42 2e-05 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 0.30 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 6.2 AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprot... 23 8.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.2 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 4e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +1 Query: 64 MRECISVHVGQAGVQIGNACWE 129 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 41.1 bits (92), Expect = 2e-05 Identities = 26/68 (38%), Positives = 28/68 (41%) Frame = +2 Query: 119 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTYPVXXXXXXXXXXXXXX 298 P T WS AS+ RCP+TR S ST SS R AST PV Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMRC 78 Query: 299 XXAHTDSC 322 A T SC Sbjct: 79 APARTASC 86 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 2e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect(2) = 0.30 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 170 CPQTRPSGVETILSTLSSARPELAS 244 C RPS ++ ++ S RP+LA+ Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAA 188 Score = 21.8 bits (44), Expect(2) = 0.30 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 113 VMPAGSFTAWSTASSLMARCPQTRPSGV 196 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 192 GWRRFFQHFLQRDRSWQAR 248 GW + HF QR R W R Sbjct: 12 GWLWIYLHFNQRYRFWVER 30 >AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprotein transferase protein. Length = 103 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 Query: 306 HIQTVVSSRTTYYW*GRCGQQLCPWSLHHW 395 H + +RT +Y RC + C + ++W Sbjct: 66 HNMGMAFNRTMWYEIVRCARHFCEYDDYNW 95 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 93 PSRSPDR*CLLGALLPGARHPA*WPDAHRQDHR 191 P+ P + L+ +LP + PA P R+D R Sbjct: 1107 PAVEPAKKTLVATILPNSAKPAQQPPPLRRDAR 1139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,006 Number of Sequences: 2352 Number of extensions: 12733 Number of successful extensions: 27 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -