BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303C03f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1 |Sc... 32 0.045 SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha... 26 3.9 SPBC354.02c |sec61||translocon alpha subunit Sec61|Schizosacchar... 26 3.9 SPBC409.08 |||spermine family transporter |Schizosaccharomyces p... 25 5.2 SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3||... 25 6.8 >SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 935 Score = 32.3 bits (70), Expect = 0.045 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 137 RKLLRYFKKINVDAKEMRGVGIQVTKLVLIIKQQSK 244 +K+ +K INVD ++RG+G+Q K IIK SK Sbjct: 606 KKVTSMYKTINVDPGDVRGIGLQALK---IIKDNSK 638 >SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase Alg10|Schizosaccharomyces pombe|chr 1|||Manual Length = 445 Score = 25.8 bits (54), Expect = 3.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 300 SLLIFMIVGLLQRNLLMAPLLCCLIISTNFVTCIPTPLI 184 S LI L L M L L+IST +T +P PL+ Sbjct: 346 SYLILYYFFLDISKLQMTSLTFFLLISTTILTLVPAPLV 384 >SPBC354.02c |sec61||translocon alpha subunit Sec61|Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 25.8 bits (54), Expect = 3.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 20 SGLKKHQLRLQSLWVMDIVMSLINQIIYLQ 109 SGL Q++L +LW + + +IYLQ Sbjct: 239 SGLTSSQIQLPNLWNFFATLLVFGVVIYLQ 268 >SPBC409.08 |||spermine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 25.4 bits (53), Expect = 5.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 Query: 297 LLIFMIVGLLQRNLLMAPLLCCLIISTNFVTCIPTPLISLASTFI 163 L+ MI +LQ +AP + CL+I F C ++LA I Sbjct: 171 LVTLMIYIVLQIPCALAPNIACLLIVRFFCGCFGCTPLTLAGGVI 215 >SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 465 Score = 25.0 bits (52), Expect = 6.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 312 SVLDSLLIFMIVGLLQRNLLMAPLLCCLIISTNFVTCI 199 SVL +L+ + L+ NL + L L +S F TC+ Sbjct: 148 SVLSGVLLISLPTLILLNLCILKLAAKLHLSALFTTCL 185 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,560,917 Number of Sequences: 5004 Number of extensions: 23836 Number of successful extensions: 76 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -