BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303C03f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-120|AAF47401.1| 995|Drosophila melanogaster CG12189-PA... 65 6e-11 AB049435-1|BAB15801.1| 995|Drosophila melanogaster dREV1 protein. 65 6e-11 >AE014296-120|AAF47401.1| 995|Drosophila melanogaster CG12189-PA protein. Length = 995 Score = 64.9 bits (151), Expect = 6e-11 Identities = 27/49 (55%), Positives = 40/49 (81%) Frame = +1 Query: 7 VKLMVRAEEAPVETAKFMGHGYCNVINKSNNLPAATNDVEVLTQETIEI 153 +K+MVRA EAPVET+K+MGHG C++INKS+ + AT+DV V+T +++ Sbjct: 607 LKIMVRAAEAPVETSKYMGHGVCDIINKSSLIKYATDDVNVITTVVLDL 655 >AB049435-1|BAB15801.1| 995|Drosophila melanogaster dREV1 protein. Length = 995 Score = 64.9 bits (151), Expect = 6e-11 Identities = 27/49 (55%), Positives = 40/49 (81%) Frame = +1 Query: 7 VKLMVRAEEAPVETAKFMGHGYCNVINKSNNLPAATNDVEVLTQETIEI 153 +K+MVRA EAPVET+K+MGHG C++INKS+ + AT+DV V+T +++ Sbjct: 607 LKIMVRAAEAPVETSKYMGHGVCDIINKSSLIKYATDDVNVITTVVLDL 655 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,231,520 Number of Sequences: 53049 Number of extensions: 239419 Number of successful extensions: 562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -