BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303B11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 38 2e-04 AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding pr... 24 2.7 AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding pr... 24 2.7 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 38.3 bits (85), Expect = 2e-04 Identities = 27/114 (23%), Positives = 59/114 (51%), Gaps = 4/114 (3%) Frame = +3 Query: 192 GQFATVYKAKDAKTDKIVAVKKIKIGSRLEAQDGINRTAL-REIKLLQELQHINLIGLLD 368 G F+ V + ++++ AVK + + ++ A G++ + L RE + L+H +++ LL+ Sbjct: 1 GPFSIVRRCIHRESNQQFAVKIVDV-AKFTASPGLSTSDLKREATICHMLKHPHIVELLE 59 Query: 369 VFGQKSNVSLVFDFMDTDL--EIIIKDNT-IVLTPANVKAYMIMTLKGLEYLHQ 521 + + + +VFD +D+ E++ + V + A Y+ L+ L Y H+ Sbjct: 60 TYSSEGMLYMVFDMEGSDICFEVVRRAVAGFVYSEAVACHYLRQILEALRYCHE 113 >AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding protein AgamOBP56 protein. Length = 181 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 179 LFGR-RTVCNCVQSKGCKNRQNCCCEEN 259 +FGR R + VQ CK + CC + N Sbjct: 13 MFGRFRRSASEVQDDKCKRKYKCCNDAN 40 >AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding protein OBPjj7a protein. Length = 235 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +2 Query: 179 LFGR-RTVCNCVQSKGCKNRQNCCCEEN 259 +FGR R + VQ CK + CC + N Sbjct: 41 MFGRFRRSASEVQDDKCKRKYKCCNDAN 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 482,215 Number of Sequences: 2352 Number of extensions: 8498 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -