BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303B04f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.15 |meu13|SPAC821.01|Tat binding protein 1|Schizosacchar... 28 0.97 SPBC11C11.01 ||SPBC17D1.08|RNA-binding protein|Schizosaccharomyc... 26 3.9 SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large... 25 5.2 SPAC2G11.14 |taf111|taf1, taf1, taf130|transcription factor TFII... 25 9.0 >SPAC222.15 |meu13|SPAC821.01|Tat binding protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 27.9 bits (59), Expect = 0.97 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 128 ESNKLIYEHLHKPNRIYEQNEI 193 E+ KL+YE+L K NR Y ++ Sbjct: 16 EAEKLVYEYLRKTNRPYSATDV 37 >SPBC11C11.01 ||SPBC17D1.08|RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 493 Score = 25.8 bits (54), Expect = 3.9 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +2 Query: 65 WSRGD*LKPLFRNDRSKKLIIESNKLIYEHLHKPNRIYEQNEI 193 WS + K + RN+ L ++ L +E K I +N++ Sbjct: 72 WSFNNITKSVIRNEHGNNLTLQEELLRHEAYEKNEEIANENDV 114 >SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large subunit Rpc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1405 Score = 25.4 bits (53), Expect = 5.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 73 WRLIKTFISKRSLQEINNRIQQAHLRTSTQTKSN 174 W K I + + +NN +QQ H+ TS+ KS+ Sbjct: 1167 WNTPKLKIPSQQVT-VNNTLQQIHVHTSSDGKSS 1199 >SPAC2G11.14 |taf111|taf1, taf1, taf130|transcription factor TFIID complex subunit Taf111|Schizosaccharomyces pombe|chr 1|||Manual Length = 979 Score = 24.6 bits (51), Expect = 9.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 129 SIINFLERSFRNKGFNQSPRLHFDSTLKLNN 37 S+IN L N G N+SP++ DS+ + +N Sbjct: 35 SVINSLLGDTNNPGMNESPKI-LDSSFENSN 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,841,091 Number of Sequences: 5004 Number of extensions: 31894 Number of successful extensions: 64 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -