BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303B01f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 4.7 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 6.2 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 8.2 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 4.7 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = -3 Query: 393 HHG*WQEPPPNLIRFVR-----NCGGPGNSSAGSAVLTPQRNDHLCA 268 HH Q+PPP + + PG S SAV+TP H A Sbjct: 823 HHHAAQQPPPGSHPGAQTQPQLSQHPPGASGRSSAVITPPSTHHQAA 869 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.0 bits (47), Expect = 6.2 Identities = 14/54 (25%), Positives = 20/54 (37%) Frame = -2 Query: 271 RLFWREHLHASVDGRELRESTRTPTSTKWIRERCAQITGRDFVQFVHTHINALP 110 R F H H + R +TP K I++ C + G D + H P Sbjct: 138 RSFLCYHQHYGYLRKTDRYVPKTPLEMKQIQQDCVDVYGLDPARLNHYQDGQFP 191 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 449 GASDHPGPHCEAFRGARLVT 390 G DHP P + R ++VT Sbjct: 842 GVPDHPAPFLQFLRRTKVVT 861 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,037 Number of Sequences: 2352 Number of extensions: 12231 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -