BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A12f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ133776-1|CAB45384.1| 214|Homo sapiens neurogenin 3 protein. 32 1.1 BC126468-1|AAI26469.1| 214|Homo sapiens neurogenin 3 protein. 32 1.4 BC117488-1|AAI17489.1| 214|Homo sapiens neurogenin 3 protein. 32 1.4 BC074939-1|AAH74939.1| 214|Homo sapiens neurogenin 3 protein. 32 1.4 BC074938-1|AAH74938.1| 214|Homo sapiens neurogenin 3 protein. 32 1.4 BC069098-1|AAH69098.1| 214|Homo sapiens neurogenin 3 protein. 32 1.4 AL450311-1|CAH72729.1| 214|Homo sapiens neurogenin 3 protein. 32 1.4 AF234829-1|AAK15022.1| 214|Homo sapiens neurogenin 3 protein. 32 1.4 M94132-1|AAA59164.1| 984|Homo sapiens MUC2 protein. 31 3.2 L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein. 31 3.2 Z30425-1|CAA83016.1| 348|Homo sapiens orphan nuclear hormone re... 29 7.5 DQ022681-1|AAY56401.1| 357|Homo sapiens nuclear receptor subfam... 29 7.5 BC121121-1|AAI21122.1| 309|Homo sapiens nuclear receptor subfam... 29 7.5 BC121120-1|AAI21121.1| 314|Homo sapiens nuclear receptor subfam... 29 7.5 BC069651-1|AAH69651.1| 274|Homo sapiens NR1I3 protein protein. 29 7.5 BC069626-1|AAH69626.1| 352|Homo sapiens nuclear receptor subfam... 29 7.5 AY572827-1|AAT47180.1| 319|Homo sapiens constitutive androstane... 29 7.5 AY572819-1|AAT47172.1| 321|Homo sapiens constitutive androstane... 29 7.5 AY572818-1|AAT47171.1| 288|Homo sapiens constitutive androstane... 29 7.5 AY572817-1|AAT47170.1| 293|Homo sapiens constitutive androstane... 29 7.5 AY572816-1|AAT47169.1| 249|Homo sapiens constitutive androstane... 29 7.5 AY572813-1|AAT47166.1| 278|Homo sapiens constitutive androstane... 29 7.5 AY572812-1|AAT47165.1| 297|Homo sapiens constitutive androstane... 29 7.5 AY572811-1|AAT47164.1| 324|Homo sapiens constitutive androstane... 29 7.5 AY572810-1|AAT47163.1| 309|Homo sapiens constitutive androstane... 29 7.5 AY572808-1|AAT47161.1| 280|Homo sapiens constitutive androstane... 29 7.5 AY572806-1|AAT47159.1| 322|Homo sapiens constitutive androstane... 29 7.5 AL590714-14|CAH72154.1| 348|Homo sapiens nuclear receptor subfa... 29 7.5 AL590714-13|CAH72153.1| 352|Homo sapiens nuclear receptor subfa... 29 7.5 AF263918-1|AAF73293.1| 910|Homo sapiens inner nuclear membrane ... 29 9.9 AF112299-1|AAD31593.2| 911|Homo sapiens integral inner nuclear ... 29 9.9 >AJ133776-1|CAB45384.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 32.3 bits (70), Expect = 1.1 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTPGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >BC126468-1|AAI26469.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >BC117488-1|AAI17489.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >BC074939-1|AAH74939.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >BC074938-1|AAH74938.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >BC069098-1|AAH69098.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >AL450311-1|CAH72729.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >AF234829-1|AAK15022.1| 214|Homo sapiens neurogenin 3 protein. Length = 214 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/69 (30%), Positives = 27/69 (39%) Frame = +2 Query: 236 QKAGIAVLLCTHTPERGLRSCTEDGRCTPCS*RRSPFGTVPAAAEIQAGGCSKSPANSPL 415 Q +G + T ER +ED P S SP T AE + GGC +P Sbjct: 4 QPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRA 63 Query: 416 RRHFSEPPR 442 RR P+ Sbjct: 64 RRGGRSRPK 72 >M94132-1|AAA59164.1| 984|Homo sapiens MUC2 protein. Length = 984 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 314 CTPCS*RRSPFGTVPAAAEIQAGGCSKS 397 CTP + R P TVP E+ GC+K+ Sbjct: 870 CTPRNETRVPCSTVPVTTEVSYAGCTKT 897 >L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein. Length = 5179 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 314 CTPCS*RRSPFGTVPAAAEIQAGGCSKS 397 CTP + R P TVP E+ GC+K+ Sbjct: 5065 CTPRNETRVPCSTVPVTTEVSYAGCTKT 5092 >Z30425-1|CAA83016.1| 348|Homo sapiens orphan nuclear hormone receptor protein. Length = 348 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >DQ022681-1|AAY56401.1| 357|Homo sapiens nuclear receptor subfamily 1, group I, member 3 protein. Length = 357 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >BC121121-1|AAI21122.1| 309|Homo sapiens nuclear receptor subfamily 1, group I, member 3 protein. Length = 309 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >BC121120-1|AAI21121.1| 314|Homo sapiens nuclear receptor subfamily 1, group I, member 3 protein. Length = 314 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >BC069651-1|AAH69651.1| 274|Homo sapiens NR1I3 protein protein. Length = 274 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >BC069626-1|AAH69626.1| 352|Homo sapiens nuclear receptor subfamily 1, group I, member 3 protein. Length = 352 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >AY572827-1|AAT47180.1| 319|Homo sapiens constitutive androstane receptor SV22 protein. Length = 319 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >AY572819-1|AAT47172.1| 321|Homo sapiens constitutive androstane receptor SV14 protein. Length = 321 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >AY572818-1|AAT47171.1| 288|Homo sapiens constitutive androstane receptor SV13 protein. Length = 288 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >AY572817-1|AAT47170.1| 293|Homo sapiens constitutive androstane receptor SV12 protein. Length = 293 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >AY572816-1|AAT47169.1| 249|Homo sapiens constitutive androstane receptor SV11 protein. Length = 249 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >AY572813-1|AAT47166.1| 278|Homo sapiens constitutive androstane receptor SV8 protein. Length = 278 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >AY572812-1|AAT47165.1| 297|Homo sapiens constitutive androstane receptor SV7 protein. Length = 297 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >AY572811-1|AAT47164.1| 324|Homo sapiens constitutive androstane receptor SV6 protein. Length = 324 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >AY572810-1|AAT47163.1| 309|Homo sapiens constitutive androstane receptor SV5 protein. Length = 309 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >AY572808-1|AAT47161.1| 280|Homo sapiens constitutive androstane receptor SV3 protein. Length = 280 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 52 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 106 >AY572806-1|AAT47159.1| 322|Homo sapiens constitutive androstane receptor SV1 protein. Length = 322 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >AL590714-14|CAH72154.1| 348|Homo sapiens nuclear receptor subfamily 1, group I, member 3 protein. Length = 348 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >AL590714-13|CAH72153.1| 352|Homo sapiens nuclear receptor subfamily 1, group I, member 3 protein. Length = 352 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 291 VLVLKTGGVRHVPDVVLRLELYPLQLRSRQEDVVRAL---RTHHFGVTFRSLLEF 446 +L + +R R + P+QL QE+++R L T H G F ++F Sbjct: 81 ILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQF 135 >AF263918-1|AAF73293.1| 910|Homo sapiens inner nuclear membrane protein protein. Length = 910 Score = 29.1 bits (62), Expect = 9.9 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -3 Query: 438 GGSEK*RRSGEFAGLLLHPPAWISAAAGTVPNG-ERRQEH---GVHRPSSVQERRP 283 GG K R S ++ GL PPA ++A+ T N ERR+ H G RP+ + + P Sbjct: 156 GGGRKDRASLQYRGLKA-PPAPLAASEVTNSNSAERRKPHSWWGARRPAGPELQTP 210 >AF112299-1|AAD31593.2| 911|Homo sapiens integral inner nuclear membrane protein MAN1 protein. Length = 911 Score = 29.1 bits (62), Expect = 9.9 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -3 Query: 438 GGSEK*RRSGEFAGLLLHPPAWISAAAGTVPNG-ERRQEH---GVHRPSSVQERRP 283 GG K R S ++ GL PPA ++A+ T N ERR+ H G RP+ + + P Sbjct: 156 GGGRKDRASLQYRGLKA-PPAPLAASEVTNSNSAERRKPHSWWGARRPAGPELQTP 210 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,716,857 Number of Sequences: 237096 Number of extensions: 1570028 Number of successful extensions: 3985 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 3857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3984 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -