BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A09f (504 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 1.2 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 8.3 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 8.3 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 8.3 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 8.3 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 166 IESIPELPSGLIGYD*TGRAV 104 ++ +PE+P GL D +GR+V Sbjct: 892 VQEVPEVPYGLKVLDKSGRSV 912 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.4 bits (48), Expect = 1.2 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 192 NAALPWCSSSRTGLRAKTSPSCFRRASMISCELSHSPSTP 311 NAA ++ ++ TSPS F RAS +S +S S S P Sbjct: 150 NAAAVAAAAQQSHRLMMTSPSGFNRAS-VSPLISSSSSPP 188 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 20.6 bits (41), Expect = 8.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 308 CTRRVGELA*DHRSAPEAARRSL 240 C RR D R+A +AARR + Sbjct: 120 CPRREWSSPPDARAASDAARRGV 142 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 8.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 308 CTRRVGELA*DHRSAPEAARRSL 240 C RR D R+A +AARR + Sbjct: 276 CPRREWSSPPDARAASDAARRGV 298 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 20.6 bits (41), Expect = 8.3 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 324 N*TWPRACPSALCDPTSD 377 N W R+ P+ C P SD Sbjct: 210 NVQWVRSIPAFTCLPLSD 227 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 20.6 bits (41), Expect = 8.3 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 324 N*TWPRACPSALCDPTSD 377 N W R+ P+ C P SD Sbjct: 210 NVQWVRSIPAFTCLPLSD 227 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,744 Number of Sequences: 336 Number of extensions: 1450 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -