Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS303A09f
         (504 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z73424-3|CAA97781.2| 1150|Caenorhabditis elegans Hypothetical pr...    29   1.4  

>Z73424-3|CAA97781.2| 1150|Caenorhabditis elegans Hypothetical
           protein C44B9.4 protein.
          Length = 1150

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +2

Query: 119 LVVPNQPARKFWDGFDLAVKRLRDERGAPMVLKLKDWPPGEDFAELLPA-RFDDLMRALP 295
           L V N+  R  W+  +    RLRDE  A  + K   + P  +FAE+    R  +L++AL 
Sbjct: 126 LRVENENHRN-WEAIEYHCNRLRDEEQAEKMKKDVAYGPKSEFAEIQDCFRDKNLLKALG 184

Query: 296 LS 301
           ++
Sbjct: 185 MA 186


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,550,463
Number of Sequences: 27780
Number of extensions: 148539
Number of successful extensions: 376
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 365
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 376
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 967231538
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)