BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A07f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 25 0.62 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.62 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 3.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 3.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.4 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 7.7 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 24.6 bits (51), Expect = 0.62 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 17 PRHHTTLFNYDRYLTEYEHDID 82 PRH + L N + +T++E D+D Sbjct: 175 PRHASDLDNCNHLMTKFEPDLD 196 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.62 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = +1 Query: 235 FPNSCRPTLTPSRFTTTLSLPLR----GLRYPATVTCLSIARSTATPRALSMPTTT 390 F +SC P P S PL PAT+T + +T T A + TTT Sbjct: 75 FSSSCDPV--PGNLEQIGSRPLHPPASSTSLPATITTTTTTTTTTTATAAATATTT 128 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 229 LRRVGLYLSSALMSSEPFRERT 164 L++VG + + E FRERT Sbjct: 67 LKKVGFVNADTTFNEEKFRERT 88 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 164 RAFSKRFGRHQSRGKVQANTPQRFSRTPVDLP 259 +AF+++ + S GK+ A P FS P Sbjct: 337 KAFARKKTDYSSFGKILATEPTLFSNVTPKFP 368 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -1 Query: 446 TSHASWHVVDWPVIIERARVVVGIDRARGVAVDLAMD 336 T+ W ++D + +R +D R V VD+ M+ Sbjct: 1088 TNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMN 1124 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 197 SRGKVQANTPQRFSRTPVDLP 259 SR + +AN +R P+++P Sbjct: 162 SRAREEANVVPEGARVPIEIP 182 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,918 Number of Sequences: 438 Number of extensions: 3743 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -