BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A06f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9VFX9 Cluster: CG11686-PA; n=3; Endopterygota|Rep: CG1... 47 2e-04 UniRef50_A0NBB7 Cluster: ENSANGP00000031397; n=2; Culicidae|Rep:... 47 2e-04 UniRef50_Q55641 Cluster: Ribonuclease D; n=29; Cyanobacteria|Rep... 37 0.32 UniRef50_A7S654 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ... 36 0.74 UniRef50_Q8IC31 Cluster: Putative uncharacterized protein MAL7P1... 33 3.0 UniRef50_A6CQD0 Cluster: Flagellar protein; n=1; Bacillus sp. SG... 32 9.2 UniRef50_A0D4A2 Cluster: Chromosome undetermined scaffold_37, wh... 32 9.2 >UniRef50_Q9VFX9 Cluster: CG11686-PA; n=3; Endopterygota|Rep: CG11686-PA - Drosophila melanogaster (Fruit fly) Length = 70 Score = 47.2 bits (107), Expect = 2e-04 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = +3 Query: 150 VLPFTVCIEALSGLADFLLSVVQFPKYCAQAMMEGR 257 V F CI AL+G++D LL VQFP YC +AM+EG+ Sbjct: 32 VYAFASCIPALTGISDILLQGVQFPFYCGKAMLEGK 67 >UniRef50_A0NBB7 Cluster: ENSANGP00000031397; n=2; Culicidae|Rep: ENSANGP00000031397 - Anopheles gambiae str. PEST Length = 70 Score = 47.2 bits (107), Expect = 2e-04 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +3 Query: 150 VLPFTVCIEALSGLADFLLSVVQFPKYCAQAMMEGR 257 + P TVCI LSG++D LL QF YCAQ M+ GR Sbjct: 32 IYPITVCIPKLSGVSDILLKGAQFAHYCAQCMINGR 67 >UniRef50_Q55641 Cluster: Ribonuclease D; n=29; Cyanobacteria|Rep: Ribonuclease D - Synechocystis sp. (strain PCC 6803) Length = 217 Score = 36.7 bits (81), Expect = 0.32 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -1 Query: 329 LKFTIMISIYDTLTTKIMSKLIKSSSFHHGLRAILREL 216 LK T I Y TKI SK+ ++ + HHGL+ +++EL Sbjct: 97 LKHTFDIKTYPIFCTKIASKIARTYTSHHGLKTLVQEL 134 >UniRef50_A7S654 Cluster: Predicted protein; n=2; Eumetazoa|Rep: Predicted protein - Nematostella vectensis Length = 69 Score = 35.5 bits (78), Expect = 0.74 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 156 PFTVCIEALSGLADFLLSVVQFPKYCAQAMMEGR 257 PF CI+AL GL + L+ V P A+ M+EG+ Sbjct: 33 PFEACIDALKGLTELLMKGVMLPLEVAKHMVEGK 66 >UniRef50_Q8IC31 Cluster: Putative uncharacterized protein MAL7P1.15; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL7P1.15 - Plasmodium falciparum (isolate 3D7) Length = 4230 Score = 33.5 bits (73), Expect = 3.0 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +1 Query: 250 KEEDLINLDIIFVVNVSYIDIIIV-NFNYGAIYVLKP-FWFVIY 375 K +NL F NV +++III+ NF++ +Y+L F+F++Y Sbjct: 128 KNISFLNLGNFFYDNVHFLEIIILNNFHHNRVYILSTIFYFLLY 171 >UniRef50_A6CQD0 Cluster: Flagellar protein; n=1; Bacillus sp. SG-1|Rep: Flagellar protein - Bacillus sp. SG-1 Length = 796 Score = 31.9 bits (69), Expect = 9.2 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = -3 Query: 432 VECNTGTPYLSENFPLKRRVNNKPKRFEYIDGTIIKVYYNDID 304 VE + TP L+E K V NKP E GT+ K + +DID Sbjct: 281 VEITSATPDLNETDSFKVDVVNKPSEVEV--GTLTKTFISDID 321 >UniRef50_A0D4A2 Cluster: Chromosome undetermined scaffold_37, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_37, whole genome shotgun sequence - Paramecium tetraurelia Length = 1162 Score = 31.9 bits (69), Expect = 9.2 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 300 VYRYHYSKL*LWCHLCTQTFLVCYLLSV-LAGNFHSDMVYQCCTLQHKYRTTENKLFYLA 476 + ++H S H Q CY+ + L N+HSD+ YQ C Q + +N F+ Sbjct: 176 ILKHHLSTQTFTAHPLCQIIRGCYIEHITLKQNYHSDLAYQAC--QQLVKLIDNINFHGL 233 Query: 477 IT 482 +T Sbjct: 234 VT 235 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 509,305,983 Number of Sequences: 1657284 Number of extensions: 10032061 Number of successful extensions: 22085 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 21562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22079 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -