BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A06f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45352| Best HMM Match : PAN (HMM E-Value=0.00031) 32 0.33 SB_57632| Best HMM Match : Fibrinogen_C (HMM E-Value=8) 31 0.76 SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) 31 0.76 SB_45350| Best HMM Match : PAN (HMM E-Value=0.00039) 31 0.76 SB_46871| Best HMM Match : PAN (HMM E-Value=1) 29 1.8 SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) 28 4.1 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 28 4.1 SB_2085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 28 4.1 SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) 28 4.1 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 28 4.1 SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 >SB_45352| Best HMM Match : PAN (HMM E-Value=0.00031) Length = 332 Score = 31.9 bits (69), Expect = 0.33 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 408 MVYQCCTLQHKYRTTENKLFYLAITDHYEEREYCPLES 521 M+++ C+ KY TEN L+YL T H YC S Sbjct: 119 MLFKQCSDHFKYGVTENGLYYLQDTHHNWYPVYCDFTS 156 >SB_57632| Best HMM Match : Fibrinogen_C (HMM E-Value=8) Length = 214 Score = 30.7 bits (66), Expect = 0.76 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 408 MVYQCCTLQHKYRTTENKLFYLAITDHYEEREYCPLES 521 M+++ C+ KY T+N L+YL T H YC S Sbjct: 1 MLFKQCSDHFKYGVTQNGLYYLQDTHHNWYPVYCDFTS 38 >SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) Length = 623 Score = 30.7 bits (66), Expect = 0.76 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGWHLH 145 + ++FH+++NH D H +L + G+ H Sbjct: 572 EHIIFHDIMNHLDTHNILVKFQHGFRRH 599 >SB_45350| Best HMM Match : PAN (HMM E-Value=0.00039) Length = 334 Score = 30.7 bits (66), Expect = 0.76 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 408 MVYQCCTLQHKYRTTENKLFYLAITDHYEEREYCPLES 521 M+++ C+ KY T+N L+YL T H YC S Sbjct: 121 MLFKQCSDHFKYGVTQNGLYYLQDTHHNWYPVYCDFTS 158 >SB_46871| Best HMM Match : PAN (HMM E-Value=1) Length = 525 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +1 Query: 250 KEEDLINLDI---IFVVNVSYIDIIIVNFNYGAIYVLKPFW 363 K E+LIN + ++N SY DI+ V YV+ FW Sbjct: 295 KRENLINCHVSPHFLIINGSYFDIVCVLLRMRGGYVVSYFW 335 >SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) Length = 168 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 43 EHIIFHDIMNHLDTHNILVKFQHGF 67 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 88 EHIIFHDIMNHLDTHNILVKFQHGF 112 >SB_2085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -2 Query: 256 LPSIMACAQYFGN*TTDNRKSAKPDNASMHTVNGSTIM*MPA 131 LPS M A GN T R S KP AS+ NG PA Sbjct: 11 LPSTMCLATSRGNITPFIRSSVKPLRASIQASNGDKHTYQPA 52 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 177 EHIIFHDIMNHLDTHNILVKFQHGF 201 >SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 672 EHIIFHDIMNHIDTHNILVKFQHGF 696 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 291 EHIIFHDIMNHLDTHNILVKFQHGF 315 >SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) Length = 560 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 502 EHIIFHDIMNHLDTHNILVKFQHGF 526 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 128 EHIIFHDIMNHLDTHNILVKFQHGF 152 >SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 27.9 bits (59), Expect = 5.4 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 62 QRVVFHNLVNHFDIHCLLGSWNSGW 136 + ++FH+++NH D H +L + G+ Sbjct: 687 KHIIFHDIMNHLDTHNILVKFQHGF 711 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,812,004 Number of Sequences: 59808 Number of extensions: 325809 Number of successful extensions: 754 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 753 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -