BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A06f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U44128-1|AAC50355.1| 1030|Homo sapiens thiazide-sensitive Na-Cl ... 30 4.3 X91220-1|CAA62613.1| 1021|Homo sapiens NaCl electroneutral Thiaz... 30 5.7 >U44128-1|AAC50355.1| 1030|Homo sapiens thiazide-sensitive Na-Cl protein. Length = 1030 Score = 30.3 bits (65), Expect = 4.3 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 131 GWHLHYCTSVHSVHRGVI-WFSRFPIISGSIPEVLRAG 241 GW+ CT HS H G+I ++ ++SG P ++ AG Sbjct: 424 GWNFTECTQQHSCHYGLINYYQTMSMVSGFAP-LITAG 460 >X91220-1|CAA62613.1| 1021|Homo sapiens NaCl electroneutral Thiazide-sensitive cotransporter protein. Length = 1021 Score = 29.9 bits (64), Expect = 5.7 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 131 GWHLHYCTSVHSVHRGVI-WFSRFPIISGSIP 223 GW+ CT HS H G+I ++ ++SG P Sbjct: 424 GWNFTECTQQHSCHYGLINYYQTMSMVSGFAP 455 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,766,676 Number of Sequences: 237096 Number of extensions: 1485634 Number of successful extensions: 5877 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5877 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -