BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A06f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 4.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.7 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 7.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.7 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 7.7 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 303 YRYHYSKL*LWCHLCTQTFLVCYLLSVLAGNFHSDMVYQC 422 YR H + C C+++F V LSV + Y+C Sbjct: 111 YRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYKC 150 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = -3 Query: 447 YGTYVVECNTGTPYLSENFPLKRRVN 370 Y Y++ N YL+ ++ L+ ++N Sbjct: 196 YKEYIIPANYSGWYLNHDYNLENKLN 221 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 Query: 390 PLKRRVNNKPKRFEYIDGTIIKV 322 P+ +VNN +ID T I++ Sbjct: 301 PVTEKVNNDSNSLPFIDRTPIEI 323 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 271 LDIIFVVNVSYIDIIIVNFNYG 336 ++I+ + SY+ II NYG Sbjct: 272 VEIVMKMKWSYVSIIYEESNYG 293 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 Query: 390 PLKRRVNNKPKRFEYIDGTIIKV 322 P+ +VNN +ID T I++ Sbjct: 301 PVTEKVNNDSNSLPFIDRTPIEI 323 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,578 Number of Sequences: 438 Number of extensions: 3346 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -