BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A05f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CBE11 Cluster: C2 domain containing protein; n=... 35 1.3 >UniRef50_UPI00006CBE11 Cluster: C2 domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: C2 domain containing protein - Tetrahymena thermophila SB210 Length = 757 Score = 34.7 bits (76), Expect = 1.3 Identities = 24/77 (31%), Positives = 38/77 (49%) Frame = -2 Query: 325 LIVKMLGPMLIVPSHPIMQDKDDVPSPASLKLAIIFFEHN*H*FYGLISDL*EPMFLIIC 146 LI K+LG + V H ++K ++PSP LK I H + GLI + ++ Sbjct: 45 LIEKILGDRIYVLPHDY-KEKSNLPSPNDLKYKFILIGKLPHQYDGLIQEQYTTQDIMKL 103 Query: 145 SLTR*TPYEKLSIFIQP 95 T+ TP + ++I QP Sbjct: 104 QQTQHTPAQNVTISPQP 120 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 456,372,660 Number of Sequences: 1657284 Number of extensions: 8208199 Number of successful extensions: 16935 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16934 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -