BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A05f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0431 + 3283252-3283274,3283684-3283819,3285839-3286682,328... 27 9.1 >07_01_0431 + 3283252-3283274,3283684-3283819,3285839-3286682, 3286785-3286856,3286906-3286937,3287020-3287433 Length = 506 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 8 FVGSTYVGTLTRLTPHGP-NSKKKLTGEHCGLNENTQ 115 F+G Y G LTRL P N K L E+C + ++ Q Sbjct: 244 FLGILYCGMLTRLQTSQPLNQLKHLQVENCTMLQDIQ 280 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,854,196 Number of Sequences: 37544 Number of extensions: 214398 Number of successful extensions: 395 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -