BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303A02f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0300 + 23932947-23933196,23934022-23934123,23934249-239343... 50 9e-07 01_06_1103 - 34543915-34543955,34544069-34544137,34544294-345443... 50 1e-06 01_01_1199 - 9657169-9657254,9657369-9657395,9657485-9657553,965... 49 2e-06 12_01_0231 + 1744323-1745276,1745516-1746193 28 5.2 11_02_0014 - 7352619-7352918,7353173-7353418 27 9.1 06_01_1127 + 9294079-9294193,9294300-9294369,9294611-9294716,929... 27 9.1 >05_05_0300 + 23932947-23933196,23934022-23934123,23934249-23934317, 23934406-23934446 Length = 153 Score = 50.4 bits (115), Expect = 9e-07 Identities = 24/56 (42%), Positives = 31/56 (55%) Frame = +2 Query: 65 WLQQRNRKRPSSQLTPALLW**NRAKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 232 W+ +K+ + + L KY LGYK LKTLR K KL+I+A N PPLR Sbjct: 42 WVVAMMQKKSTDNINNKLQLVMKSGKYTLGYKTVLKTLRNSKGKLIILANNCPPLR 97 >01_06_1103 - 34543915-34543955,34544069-34544137,34544294-34544395, 34545603-34545708,34545998-34546079,34546850-34547142 Length = 230 Score = 49.6 bits (113), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 140 KYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 232 KY LGYK LKTLR K KLVI+A N PPLR Sbjct: 144 KYTLGYKTVLKTLRNSKGKLVIVANNCPPLR 174 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 85 KKTIESINSRLALVMKSGKILL 150 KK E IN++L LVMKSGK L Sbjct: 126 KKNAEGINNKLQLVMKSGKYTL 147 >01_01_1199 - 9657169-9657254,9657369-9657395,9657485-9657553, 9657922-9658023,9659895-9660000,9660145-9660165 Length = 136 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 140 KYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 232 KY LGYK L+TLR KAKLVII+ N PPLR Sbjct: 26 KYTLGYKTVLRTLRNSKAKLVIISNNCPPLR 56 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = +1 Query: 64 MVAAKKQKKTIESINSRLALVMKSGKILL 150 MVAAKK KK+ ++IN++L LVMKSGK L Sbjct: 1 MVAAKKTKKSTDNINNKLQLVMKSGKYTL 29 >12_01_0231 + 1744323-1745276,1745516-1746193 Length = 543 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 1 LSRFFSICALGEDLISIYAPKMVAAKKQKKT 93 LS F EDLI+ Y P+++A K K T Sbjct: 350 LSLGFRFNPSAEDLITFYLPRLIAGKPMKDT 380 >11_02_0014 - 7352619-7352918,7353173-7353418 Length = 181 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 166 FENSSTRQSKAGYHR*KCSSAKVRLLRSRVSQYL 267 F ST K +HR SS VR +RSR QY+ Sbjct: 133 FPRESTTTGK--FHRLDGSSVNVRFMRSREDQYI 164 >06_01_1127 + 9294079-9294193,9294300-9294369,9294611-9294716, 9295665-9295805,9296377-9296475 Length = 176 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 152 GYKQTLKTLRQGKAKLVIIAKNAPPL 229 G K+ +K++R+G+ L IIA N P+ Sbjct: 48 GVKEVVKSIRRGQKGLCIIAGNISPI 73 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,160,579 Number of Sequences: 37544 Number of extensions: 237620 Number of successful extensions: 418 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -