BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H12f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p pro... 97 2e-20 AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA... 97 2e-20 BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p pro... 94 9e-20 AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA... 94 9e-20 AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA... 93 3e-19 AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p pro... 89 4e-18 AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA ... 89 4e-18 BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p pro... 86 2e-17 AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA... 86 2e-17 AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p pro... 84 1e-16 AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB ... 84 1e-16 BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p pro... 80 2e-15 AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA... 80 2e-15 AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA... 79 4e-15 AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA ... 77 1e-14 AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle pro... 77 1e-14 BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p pro... 77 2e-14 AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA ... 77 2e-14 AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle pro... 77 2e-14 BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p pro... 76 3e-14 BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p pro... 76 3e-14 BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p pro... 76 3e-14 BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p pro... 76 3e-14 BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p pro... 74 1e-13 AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA... 74 1e-13 BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p pro... 74 1e-13 AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-P... 74 1e-13 AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-P... 74 1e-13 AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA ... 73 2e-13 AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB... 73 2e-13 BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p pro... 72 4e-13 BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p pro... 72 4e-13 AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA... 72 4e-13 AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. 72 5e-13 AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. 72 5e-13 AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. 72 5e-13 AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. 72 5e-13 AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA ... 72 5e-13 AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle pro... 72 5e-13 AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p pro... 71 7e-13 AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. 71 7e-13 AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. 71 7e-13 AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. 71 7e-13 AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. 71 7e-13 AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. 71 7e-13 AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. 71 7e-13 AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. 71 7e-13 AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA... 71 7e-13 AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA ... 71 1e-12 AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle pro... 71 1e-12 AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. 69 3e-12 AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p pro... 69 5e-12 AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA ... 69 5e-12 Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystalli... 67 1e-11 AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p pro... 67 1e-11 AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-P... 67 1e-11 M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protei... 66 3e-11 AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA ... 66 3e-11 AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cutic... 66 3e-11 AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p pro... 66 4e-11 AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA... 66 4e-11 AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-P... 65 6e-11 AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-P... 65 6e-11 AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA ... 64 1e-10 AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle pro... 64 1e-10 AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p pro... 63 3e-10 AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA ... 63 3e-10 AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA... 63 3e-10 AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA... 63 3e-10 AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle pro... 63 3e-10 AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p pro... 59 3e-09 AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA ... 59 3e-09 AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle pro... 59 3e-09 AY071231-1|AAL48853.1| 217|Drosophila melanogaster RE26879p pro... 56 2e-08 AE013599-2993|AAF57484.2| 217|Drosophila melanogaster CG9036-PA... 56 2e-08 BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p pro... 55 5e-08 AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-P... 55 5e-08 AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-P... 55 7e-08 AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p pro... 54 1e-07 AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA... 54 1e-07 AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p pro... 52 5e-07 AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-P... 52 5e-07 AY071377-1|AAL48999.1| 131|Drosophila melanogaster RE40431p pro... 51 1e-06 AE014296-2696|AAF49492.1| 131|Drosophila melanogaster CG13060-P... 51 1e-06 AY071564-1|AAL49186.1| 124|Drosophila melanogaster RE63063p pro... 47 2e-05 AE014296-2695|AAF49493.1| 124|Drosophila melanogaster CG13041-P... 47 2e-05 AY071448-1|AAL49070.1| 815|Drosophila melanogaster RE53044p pro... 46 3e-05 AM294624-1|CAL26622.1| 143|Drosophila melanogaster CG13934 prot... 46 3e-05 AE013599-1762|AAF58339.2| 815|Drosophila melanogaster CG13338-P... 46 3e-05 AE014296-2698|AAF49490.1| 185|Drosophila melanogaster CG13040-P... 45 5e-05 AM294629-1|CAL26627.1| 143|Drosophila melanogaster CG13934 prot... 44 2e-04 AM294628-1|CAL26626.1| 143|Drosophila melanogaster CG13934 prot... 44 2e-04 AM294627-1|CAL26625.1| 143|Drosophila melanogaster CG13934 prot... 44 2e-04 AM294626-1|CAL26624.1| 143|Drosophila melanogaster CG13934 prot... 44 2e-04 AM294623-1|CAL26621.1| 143|Drosophila melanogaster CG13934 prot... 44 2e-04 AM294621-1|CAL26619.1| 143|Drosophila melanogaster CG13934 prot... 44 2e-04 AE014296-369|AAF47578.1| 143|Drosophila melanogaster CG13934-PA... 43 3e-04 AM294630-1|CAL26628.1| 143|Drosophila melanogaster CG13934 prot... 42 4e-04 AM294625-1|CAL26623.1| 143|Drosophila melanogaster CG13934 prot... 42 5e-04 AM294622-1|CAL26620.1| 143|Drosophila melanogaster CG13934 prot... 42 5e-04 AY070701-1|AAL48172.1| 95|Drosophila melanogaster RH37844p pro... 42 7e-04 AE014297-2974|AAF55879.1| 95|Drosophila melanogaster CG17298-P... 42 7e-04 BT023021-1|AAY55437.1| 133|Drosophila melanogaster IP04071p pro... 41 9e-04 AY084169-1|AAL89907.1| 123|Drosophila melanogaster RE40783p pro... 39 0.004 AE014296-2686|AAF49501.1| 123|Drosophila melanogaster CG4962-PA... 39 0.004 BT024391-1|ABC86453.1| 144|Drosophila melanogaster IP05345p pro... 38 0.006 AE014296-2690|AAF49497.1| 129|Drosophila melanogaster CG13063-P... 38 0.006 AE013599-1213|AAF58716.1| 100|Drosophila melanogaster CG13231-P... 38 0.006 AY071687-1|AAL49309.1| 148|Drosophila melanogaster RH10371p pro... 38 0.008 AE014296-2689|AAF49498.1| 148|Drosophila melanogaster CG13043-P... 38 0.008 BT023884-1|ABA81818.1| 697|Drosophila melanogaster RE55168p pro... 36 0.025 AY070997-1|AAL48619.1| 144|Drosophila melanogaster RE08808p pro... 36 0.025 AE014296-1307|AAN12047.1| 163|Drosophila melanogaster CG32375-P... 36 0.025 AE013599-1904|AAF58238.1| 144|Drosophila melanogaster CG10112-P... 36 0.025 BT016021-1|AAV36906.1| 662|Drosophila melanogaster RE15373p pro... 36 0.033 AE014298-2002|AAN09579.1| 662|Drosophila melanogaster CG11584-P... 36 0.033 AE014297-2840|AAF55794.1| 381|Drosophila melanogaster CG5494-PA... 36 0.044 BT022990-1|AAY55406.1| 155|Drosophila melanogaster IP08464p pro... 29 0.077 BT024389-1|ABC86451.1| 122|Drosophila melanogaster IP05464p pro... 35 0.077 AE014296-2379|AAF49745.1| 102|Drosophila melanogaster CG13482-P... 35 0.077 BT011122-1|AAR82789.1| 201|Drosophila melanogaster LD11394p pro... 34 0.10 AE014298-2000|AAF48343.1| 186|Drosophila melanogaster CG1368-PA... 34 0.10 BT021350-1|AAX33498.2| 155|Drosophila melanogaster LP19160p pro... 34 0.13 AE014296-2688|AAF49499.1| 155|Drosophila melanogaster CG13044-P... 34 0.13 AY071099-1|AAL48721.1| 153|Drosophila melanogaster RE16005p pro... 33 0.23 AE014296-1868|AAF50120.2| 153|Drosophila melanogaster CG14147-P... 33 0.23 AY070660-1|AAL48131.1| 200|Drosophila melanogaster RH04437p pro... 33 0.31 AE013599-670|AAF59073.2| 112|Drosophila melanogaster CG14752-PA... 33 0.31 BT011532-1|AAS15668.1| 131|Drosophila melanogaster RE06402p pro... 32 0.41 AY071430-1|AAL49052.1| 141|Drosophila melanogaster RE51966p pro... 32 0.41 AE014296-3153|AAF49158.2| 141|Drosophila melanogaster CG18294-P... 32 0.41 AE014296-3152|AAF49159.2| 131|Drosophila melanogaster CG12519-P... 32 0.41 AE014296-3148|AAF49161.1| 162|Drosophila melanogaster CG14095-P... 32 0.41 AE014296-3149|AAF49160.1| 122|Drosophila melanogaster CG14096-P... 32 0.54 BT029065-1|ABJ16998.1| 175|Drosophila melanogaster IP07570p pro... 31 0.72 AE013599-1482|AAF58515.1| 190|Drosophila melanogaster CG8515-PA... 31 0.72 AE014296-2697|AAF49491.2| 155|Drosophila melanogaster CG13059-P... 31 0.95 AE014296-861|AAF47911.2| 456|Drosophila melanogaster CG11350-PB... 31 0.95 AE013599-1477|AAF58517.1| 126|Drosophila melanogaster CG8510-PA... 31 0.95 AY094890-1|AAM11243.1| 517|Drosophila melanogaster RE59303p pro... 31 1.3 AY060872-1|AAL28420.1| 390|Drosophila melanogaster GM03781p pro... 31 1.3 AF145662-1|AAD38637.1| 675|Drosophila melanogaster BcDNA.GH1071... 31 1.3 AE014134-1949|AAF53007.1| 675|Drosophila melanogaster CG6495-PA... 31 1.3 AE014134-1581|AAF52726.1| 517|Drosophila melanogaster CG31886-P... 31 1.3 BT030206-1|ABN49345.1| 77|Drosophila melanogaster IP18040p pro... 30 1.7 BT029711-1|ABL75768.1| 77|Drosophila melanogaster IP17517p pro... 30 1.7 BT029646-1|ABL75705.1| 77|Drosophila melanogaster IP17217p pro... 30 1.7 AY058378-1|AAL13607.1| 650|Drosophila melanogaster GH14380p pro... 30 1.7 AE014298-800|AAF46086.2| 650|Drosophila melanogaster CG12239-PA... 30 1.7 AE013599-1761|AAF58340.2| 1093|Drosophila melanogaster CG6280-PA... 30 1.7 AF245116-1|AAF66981.1| 743|Drosophila melanogaster cactin protein. 30 2.2 AE014298-3022|AAF50904.2| 762|Drosophila melanogaster CG1676-PA... 30 2.2 AY070982-1|AAL48604.1| 306|Drosophila melanogaster RE07882p pro... 29 2.9 AE014297-436|AAF51889.2| 306|Drosophila melanogaster CG1169-PA ... 29 2.9 AE013599-3953|AAF47269.1| 92|Drosophila melanogaster CG16914-P... 29 2.9 BT023552-1|AAY84952.1| 317|Drosophila melanogaster IP09780p pro... 29 3.8 BT003229-1|AAO24984.1| 324|Drosophila melanogaster LP08773p pro... 29 3.8 AY094787-1|AAM11140.1| 977|Drosophila melanogaster LD14856p pro... 29 3.8 AY052054-1|AAK93478.1| 294|Drosophila melanogaster LP07813p pro... 29 3.8 AE014297-600|AAF54028.2| 269|Drosophila melanogaster CG31496-PA... 29 3.8 AE014296-3191|AAO41222.1| 977|Drosophila melanogaster CG8789-PC... 29 3.8 AE014296-3190|AAO41221.1| 977|Drosophila melanogaster CG8789-PB... 29 3.8 AE014296-3189|AAF49129.3| 977|Drosophila melanogaster CG8789-PA... 29 3.8 AE014296-3154|AAN11648.1| 154|Drosophila melanogaster CG32213-P... 29 3.8 AE013599-1471|AAG22279.3| 294|Drosophila melanogaster CG8502-PA... 29 3.8 AE013599-1470|AAF58521.3| 324|Drosophila melanogaster CG8502-PC... 29 3.8 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 29 5.1 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 29 5.1 BT029692-1|ABL75749.1| 77|Drosophila melanogaster IP17417p pro... 29 5.1 BT023016-1|AAY55432.1| 176|Drosophila melanogaster IP04080p pro... 29 5.1 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 29 5.1 BT004856-1|AAO45212.1| 372|Drosophila melanogaster RE59371p pro... 29 5.1 AY118689-1|AAM50549.1| 893|Drosophila melanogaster AT15637p pro... 29 5.1 AY071497-1|AAL49119.1| 1324|Drosophila melanogaster RE55745p pro... 29 5.1 AE014298-1473|AAF46608.1| 2090|Drosophila melanogaster CG9817-PA... 29 5.1 AE014297-2348|ABC66180.1| 151|Drosophila melanogaster CG34053-P... 29 5.1 AE014296-3151|AAN11647.1| 154|Drosophila melanogaster CG32208-P... 29 5.1 AE014296-3150|AAN11646.1| 141|Drosophila melanogaster CG32214-P... 29 5.1 AE014296-2071|AAF49978.2| 1324|Drosophila melanogaster CG6947-PA... 29 5.1 AE013599-3102|AAM68188.1| 889|Drosophila melanogaster CG10543-P... 29 5.1 AE013599-3101|AAO41340.1| 1024|Drosophila melanogaster CG10543-P... 29 5.1 AE013599-3100|AAF46652.3| 1634|Drosophila melanogaster CG10543-P... 29 5.1 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 29 5.1 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 29 5.1 AE013599-1008|AAF58850.1| 372|Drosophila melanogaster CG12920-P... 29 5.1 X75541-1|CAA53229.1| 1355|Drosophila melanogaster spalt protein ... 28 6.7 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 28 6.7 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 28 6.7 BT024230-1|ABC86292.1| 1283|Drosophila melanogaster LD24322p pro... 28 6.7 AY118583-1|AAM49952.1| 309|Drosophila melanogaster LD44205p pro... 28 6.7 AY094956-1|AAM11309.1| 897|Drosophila melanogaster SD01232p pro... 28 6.7 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 28 6.7 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 28 6.7 AE014297-4062|AAF56660.2| 366|Drosophila melanogaster CG6131-PA... 28 6.7 AE014297-1869|AAF55074.1| 1283|Drosophila melanogaster CG7987-PB... 28 6.7 AE014297-1868|AAF55075.1| 1283|Drosophila melanogaster CG7987-PA... 28 6.7 AE014296-2682|AAF49505.1| 206|Drosophila melanogaster CG13048-P... 28 6.7 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 28 6.7 AE014134-2066|AAF53097.3| 1365|Drosophila melanogaster CG6464-PA... 28 6.7 AE013599-2134|AAF58093.2| 309|Drosophila melanogaster CG8295-PA... 28 6.7 AB043986-1|BAA96391.1| 309|Drosophila melanogaster myelodysplas... 28 6.7 DQ375977-1|ABD37868.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375966-1|ABD37857.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375955-1|ABD37846.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375954-1|ABD37845.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375923-1|ABD37814.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375912-1|ABD37803.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375905-1|ABD37796.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375857-1|ABD37748.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375839-1|ABD37730.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ375834-1|ABD37725.1| 431|Drosophila melanogaster catsup prote... 28 8.8 DQ138902-1|ABA86508.1| 1333|Drosophila melanogaster CG6890 protein. 28 8.8 BT010037-1|AAQ22506.1| 409|Drosophila melanogaster LD43171p pro... 28 8.8 BT003277-1|AAO25034.1| 747|Drosophila melanogaster LD10638p pro... 28 8.8 AY118551-1|AAM49920.1| 1346|Drosophila melanogaster LD33590p pro... 28 8.8 AY089582-1|AAL90320.1| 304|Drosophila melanogaster RE11615p pro... 28 8.8 AY075517-1|AAL68325.1| 155|Drosophila melanogaster RE67729p pro... 28 8.8 AF247764-1|AAF86224.1| 1346|Drosophila melanogaster Toll-8 protein. 28 8.8 AF204158-1|AAF18983.1| 1346|Drosophila melanogaster cell surface... 28 8.8 AE014298-2534|AAN09435.1| 409|Drosophila melanogaster CG32564-P... 28 8.8 AE014297-4808|AAF57197.2| 304|Drosophila melanogaster CG2126-PA... 28 8.8 AE014297-4662|AAF57084.1| 747|Drosophila melanogaster CG1322-PA... 28 8.8 AE014297-4661|AAN14258.2| 859|Drosophila melanogaster CG1322-PC... 28 8.8 AE014297-4660|AAF57083.1| 1054|Drosophila melanogaster CG1322-PB... 28 8.8 AE014296-2494|AAF49650.1| 1346|Drosophila melanogaster CG6890-PA... 28 8.8 AE014296-851|AAF47903.2| 155|Drosophila melanogaster CG12607-PB... 28 8.8 AE013599-2136|AAM70968.2| 374|Drosophila melanogaster CG8295-PC... 28 8.8 AE013599-2135|AAS64849.1| 376|Drosophila melanogaster CG8295-PD... 28 8.8 >BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p protein. Length = 138 Score = 96.7 bits (230), Expect = 2e-20 Identities = 46/81 (56%), Positives = 58/81 (71%), Gaps = 2/81 (2%) Frame = +3 Query: 285 HFSP--VQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGD 458 H++P V HAPV+ HA H+ H E A KY F+Y ++DPHTGD KSQ E RDGD Sbjct: 23 HYAPALVHHAPVLSHAV------HAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGD 76 Query: 459 VVKGEYSLLQPDGSIRKVEYT 521 VVKG+YSL++PDGS+R V+YT Sbjct: 77 VVKGQYSLVEPDGSVRTVDYT 97 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 141 ATAHYTPV-LSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSY 260 A A P+ L H AP L H AP++ HA VHA PV + Y Sbjct: 12 AAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYPKY 52 >AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA protein. Length = 407 Score = 96.7 bits (230), Expect = 2e-20 Identities = 46/81 (56%), Positives = 58/81 (71%), Gaps = 2/81 (2%) Frame = +3 Query: 285 HFSP--VQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGD 458 H++P V HAPV+ HA H+ H E A KY F+Y ++DPHTGD KSQ E RDGD Sbjct: 62 HYAPALVHHAPVLSHAV------HAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAEERDGD 115 Query: 459 VVKGEYSLLQPDGSIRKVEYT 521 VVKG+YSL++PDGS+R V+YT Sbjct: 116 VVKGQYSLVEPDGSVRTVDYT 136 Score = 40.3 bits (90), Expect = 0.002 Identities = 41/152 (26%), Positives = 60/152 (39%), Gaps = 26/152 (17%) Frame = +3 Query: 141 ATAHYTPV-LSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYI--------HASPVVQHFS 293 A A P+ L H AP L H AP++ HA VHA PV + Y H + Sbjct: 51 AAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYPKYSFNYGIKDPHTGDIKSQAE 110 Query: 294 -------PVQHAPVVHHAAI-PIAVEHSDH------VEDHAPAKYEFS--YSVEDPHTGD 425 Q++ V ++ + DH V AP +S Y + DP T + Sbjct: 111 ERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPRPNTYSFGYEINDPQTQN 170 Query: 426 HKSQHETR-DGDVVKGEYSLLQPDGSIRKVEY 518 + + E R ++G Y +PDG I +Y Sbjct: 171 SQFREEKRFVNGSIQGSYGYARPDGRIEVTKY 202 >BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p protein. Length = 162 Score = 94.3 bits (224), Expect = 9e-20 Identities = 40/58 (68%), Positives = 47/58 (81%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 H +HV+ +AP KY F Y V D HTGD KSQHETRDGD VKG+YSL++PDGSIR V+YT Sbjct: 77 HDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYT 134 >AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA protein. Length = 162 Score = 94.3 bits (224), Expect = 9e-20 Identities = 40/58 (68%), Positives = 47/58 (81%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 H +HV+ +AP KY F Y V D HTGD KSQHETRDGD VKG+YSL++PDGSIR V+YT Sbjct: 77 HDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYT 134 >AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA protein. Length = 1242 Score = 92.7 bits (220), Expect = 3e-19 Identities = 57/150 (38%), Positives = 80/150 (53%), Gaps = 6/150 (4%) Frame = +3 Query: 87 GHAVSSQSIVRHDEPSH-QATAHYTPVLSHAAPVLTHAAPLIQHAGPI----VHAAPVEH 251 GHA S ++ H SH A L+H L+ + + GP+ AP Sbjct: 1066 GHAKVSPALSYHGLLSHGSGLASGASSLAHLDSSLSGYSHGVGGIGPLGAGFYRYAPSVP 1125 Query: 252 SSYIHASPVVQHFSPVQHAPVVHHAAIPIAVE-HSDHVEDHAPAKYEFSYSVEDPHTGDH 428 + HA + ++ APV HA + + E H +H + H +Y F Y+V DPHTGD+ Sbjct: 1126 ALSSHAPVAATAY--LKSAPVTQHAVLKVVPEKHLEHFDAHP--RYAFEYAVNDPHTGDN 1181 Query: 429 KSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 K Q E RDGDVVKGEYSL++PDG++R V+Y Sbjct: 1182 KHQKEERDGDVVKGEYSLVEPDGNVRTVKY 1211 >AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p protein. Length = 180 Score = 88.6 bits (210), Expect = 4e-18 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 3/76 (3%) Frame = +3 Query: 303 HAPVVHHAAIPIAVEHSDH---VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGE 473 H ++ AA I H H ++ HA KY ++Y V D HTGD KSQHE RDGDVVKG Sbjct: 24 HGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGS 83 Query: 474 YSLLQPDGSIRKVEYT 521 YSL++PDGS+R VEYT Sbjct: 84 YSLVEPDGSVRTVEYT 99 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 2/81 (2%) Frame = +3 Query: 123 DEPSHQATAHYT-PVLSHAAP-VLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSP 296 D A H T P + HAAP V+ HAAP + HA P +A + H ++ A+P V + Sbjct: 102 DHNGFNAVVHKTGPTVHHAAPAVVAHAAPAVVHAAP-AYAPAIAH--HVAAAPAVPYAGS 158 Query: 297 VQHAPVVHHAAIPIAVEHSDH 359 + H + A A H H Sbjct: 159 LAHQVPAYGYATHNAHAHVAH 179 Score = 37.9 bits (84), Expect = 0.008 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 204 LIQHAGPIVH-AAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPA 380 ++ GP VH AAP + HA+P V H +P + HH A AV ++ + PA Sbjct: 109 VVHKTGPTVHHAAP---AVVAHAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPA 165 Query: 381 KYEFSYSVEDPH 416 + Y+ + H Sbjct: 166 ---YGYATHNAH 174 Score = 31.5 bits (68), Expect = 0.72 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 7/66 (10%) Frame = +3 Query: 114 VRHDEPSHQATAHYTPVLSHAAPV----LTH---AAPLIQHAGPIVHAAPVEHSSYIHAS 272 V H P+ AH P + HAAP + H AAP + +AG + H P + +A Sbjct: 117 VHHAAPA--VVAHAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPAYGYATHNAH 174 Query: 273 PVVQHF 290 V H+ Sbjct: 175 AHVAHY 180 >AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA protein. Length = 180 Score = 88.6 bits (210), Expect = 4e-18 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 3/76 (3%) Frame = +3 Query: 303 HAPVVHHAAIPIAVEHSDH---VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGE 473 H ++ AA I H H ++ HA KY ++Y V D HTGD KSQHE RDGDVVKG Sbjct: 24 HGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGS 83 Query: 474 YSLLQPDGSIRKVEYT 521 YSL++PDGS+R VEYT Sbjct: 84 YSLVEPDGSVRTVEYT 99 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 2/81 (2%) Frame = +3 Query: 123 DEPSHQATAHYT-PVLSHAAP-VLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSP 296 D A H T P + HAAP V+ HAAP + HA P +A + H ++ A+P V + Sbjct: 102 DHNGFNAVVHKTGPTVHHAAPAVVAHAAPAVVHAAP-AYAPAIAH--HVAAAPAVPYAGS 158 Query: 297 VQHAPVVHHAAIPIAVEHSDH 359 + H + A A H H Sbjct: 159 LAHQVPAYGYATHNAHAHVAH 179 Score = 37.9 bits (84), Expect = 0.008 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 204 LIQHAGPIVH-AAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPA 380 ++ GP VH AAP + HA+P V H +P + HH A AV ++ + PA Sbjct: 109 VVHKTGPTVHHAAP---AVVAHAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPA 165 Query: 381 KYEFSYSVEDPH 416 + Y+ + H Sbjct: 166 ---YGYATHNAH 174 Score = 31.5 bits (68), Expect = 0.72 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 7/66 (10%) Frame = +3 Query: 114 VRHDEPSHQATAHYTPVLSHAAPV----LTH---AAPLIQHAGPIVHAAPVEHSSYIHAS 272 V H P+ AH P + HAAP + H AAP + +AG + H P + +A Sbjct: 117 VHHAAPA--VVAHAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPAYGYATHNAH 174 Query: 273 PVVQHF 290 V H+ Sbjct: 175 AHVAHY 180 >BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p protein. Length = 202 Score = 86.2 bits (204), Expect = 2e-17 Identities = 53/118 (44%), Positives = 69/118 (58%), Gaps = 2/118 (1%) Frame = +3 Query: 174 AAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSP-VQHAPVVHHAAIPIAVEH 350 +AP LT+AAP + A I +AAP + A+P + + +P + +AP V A P+AV Sbjct: 41 SAPGLTYAAPKLLAAPAISYAAPK-----LLAAPAISYAAPAISYAPKV--LAAPVAVAK 93 Query: 351 SDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 E + P +Y FSY V D HTGD K Q ET VV G YSL +PDG+IRKV YT Sbjct: 94 VAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYT 151 >AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA protein. Length = 188 Score = 86.2 bits (204), Expect = 2e-17 Identities = 53/118 (44%), Positives = 69/118 (58%), Gaps = 2/118 (1%) Frame = +3 Query: 174 AAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSP-VQHAPVVHHAAIPIAVEH 350 +AP LT+AAP + A I +AAP + A+P + + +P + +AP V A P+AV Sbjct: 27 SAPGLTYAAPKLLAAPAISYAAPK-----LLAAPAISYAAPAISYAPKV--LAAPVAVAK 79 Query: 351 SDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 E + P +Y FSY V D HTGD K Q ET VV G YSL +PDG+IRKV YT Sbjct: 80 VAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYT 137 >AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p protein. Length = 247 Score = 83.8 bits (198), Expect = 1e-16 Identities = 51/122 (41%), Positives = 68/122 (55%), Gaps = 2/122 (1%) Frame = +3 Query: 159 PVLSHAAPVLTHAAPLIQHAGPIVH--AAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAI 332 P++S AAP P+ AAPV A+PV +P+ APV A Sbjct: 74 PLVSKTYAAAPFAAPFAAPVAPVAARLAAPVAAPL---AAPVAPVAAPLA-APVAAPLAA 129 Query: 333 PIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKV 512 P+A + + D P +Y+F+Y V+D TGD K+Q ETRDGDVV+G YSL++PDGS R V Sbjct: 130 PVAAPIATEIVDAHP-QYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIV 188 Query: 513 EY 518 Y Sbjct: 189 SY 190 >AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB protein. Length = 247 Score = 83.8 bits (198), Expect = 1e-16 Identities = 51/122 (41%), Positives = 68/122 (55%), Gaps = 2/122 (1%) Frame = +3 Query: 159 PVLSHAAPVLTHAAPLIQHAGPIVH--AAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAI 332 P++S AAP P+ AAPV A+PV +P+ APV A Sbjct: 74 PLVSKTYAAAPFAAPFAAPVAPVAARLAAPVAAPL---AAPVAPVAAPLA-APVAAPLAA 129 Query: 333 PIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKV 512 P+A + + D P +Y+F+Y V+D TGD K+Q ETRDGDVV+G YSL++PDGS R V Sbjct: 130 PVAAPIATEIVDAHP-QYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIV 188 Query: 513 EY 518 Y Sbjct: 189 SY 190 >BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p protein. Length = 194 Score = 79.8 bits (188), Expect = 2e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 KY F+Y V D TGD KSQHETRDGDVVKG+YSL++PDGSIR V+YT Sbjct: 34 KYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYT 80 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +3 Query: 108 SIVRHDEPS-HQATAHYTPVLSHAAPVLTHAAP-LIQHAGPIVHAAPVEHSSYIHASPVV 281 ++V P+ H +P+++H PVLTH P +++H P+ HA V S A V Sbjct: 89 AVVTKSGPTVHAQAVVASPIVAHK-PVLTHYEPQVVKHVAPVAHAPLVVASP---APYVA 144 Query: 282 QHFSPVQHAPV 314 +H++P AP+ Sbjct: 145 KHYAPAAAAPI 155 Score = 37.5 bits (83), Expect = 0.011 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 3/94 (3%) Frame = +3 Query: 204 LIQHAGPIVHAAPVEHSSYIHASPVVQHFSP--VQHAPVVHHAAIPIAVEHSDHVEDHAP 377 ++ +GP VHA V S + PV+ H+ P V+H V HA + +A + +AP Sbjct: 90 VVTKSGPTVHAQAVVASPIVAHKPVLTHYEPQVVKHVAPVAHAPLVVASPAPYVAKHYAP 149 Query: 378 -AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEY 476 A Y +D + + D G Y Sbjct: 150 AAAAPIHYDYDDGYYNQGQQYEYIPQYDQYSGHY 183 >AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA protein. Length = 194 Score = 79.8 bits (188), Expect = 2e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 KY F+Y V D TGD KSQHETRDGDVVKG+YSL++PDGSIR V+YT Sbjct: 34 KYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYT 80 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +3 Query: 108 SIVRHDEPS-HQATAHYTPVLSHAAPVLTHAAP-LIQHAGPIVHAAPVEHSSYIHASPVV 281 ++V P+ H +P+++H PVLTH P +++H P+ HA V S A V Sbjct: 89 AVVTKSGPTVHAQAVVASPIVAHK-PVLTHYEPQVVKHVAPVAHAPLVVASP---APYVA 144 Query: 282 QHFSPVQHAPV 314 +H++P AP+ Sbjct: 145 KHYAPAAAAPI 155 Score = 37.5 bits (83), Expect = 0.011 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 3/94 (3%) Frame = +3 Query: 204 LIQHAGPIVHAAPVEHSSYIHASPVVQHFSP--VQHAPVVHHAAIPIAVEHSDHVEDHAP 377 ++ +GP VHA V S + PV+ H+ P V+H V HA + +A + +AP Sbjct: 90 VVTKSGPTVHAQAVVASPIVAHKPVLTHYEPQVVKHVAPVAHAPLVVASPAPYVAKHYAP 149 Query: 378 -AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEY 476 A Y +D + + D G Y Sbjct: 150 AAAAPIHYDYDDGYYNQGQQYEYIPQYDQYSGHY 183 >AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA protein. Length = 198 Score = 79.0 bits (186), Expect = 4e-15 Identities = 51/121 (42%), Positives = 62/121 (51%), Gaps = 3/121 (2%) Frame = +3 Query: 168 SHAAPVLTHAAPLIQHAGPIVHAAPVEHS-SYIHASPVVQHFSPVQ-HA-PVVHHAAIPI 338 S AAP H ++ H PV S Y + VV + + H P V H+ Sbjct: 17 SWAAP---HGGHATSYSSVTKHEGPVHKSLGYGYDHDVVSAYGGIYGHGYPSVGHSGYGY 73 Query: 339 AVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 + H H P KY+F Y V+D HTGD KSQ ETRDGD VKG YSL + DG+ R VEY Sbjct: 74 G--YDKHEPHHYP-KYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEY 130 Query: 519 T 521 T Sbjct: 131 T 131 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 87 GHAVSSQSIVRHDEPSHQATAH-YT-PVLSHAAPVLTHAAPLIQHAG 221 GHA S S+ +H+ P H++ + Y V+S + H P + H+G Sbjct: 24 GHATSYSSVTKHEGPVHKSLGYGYDHDVVSAYGGIYGHGYPSVGHSG 70 >AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA protein. Length = 221 Score = 77.4 bits (182), Expect = 1e-14 Identities = 42/95 (44%), Positives = 57/95 (60%) Frame = +3 Query: 237 APVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 416 AP+ HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D Sbjct: 20 APIAAPQVYHAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKL 72 Query: 417 TGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 TGD+K Q E RDGDVV+GEYSL+ DG R V+YT Sbjct: 73 TGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYT 107 Score = 36.3 bits (80), Expect = 0.025 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 4/106 (3%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH-APVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS 401 A VV+ +PV H A +A ++ APA SYS Sbjct: 168 APAVVKTVAPVAHYAAPAAYATYAAPTHYAAPAHYAAPAATYTSYS 213 >AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle protein protein. Length = 221 Score = 77.4 bits (182), Expect = 1e-14 Identities = 42/95 (44%), Positives = 57/95 (60%) Frame = +3 Query: 237 APVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 416 AP+ HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D Sbjct: 20 APIAAPQVYHAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKL 72 Query: 417 TGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 TGD+K Q E RDGDVV+GEYSL+ DG R V+YT Sbjct: 73 TGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYT 107 Score = 36.3 bits (80), Expect = 0.025 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 4/106 (3%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH-APVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS 401 A VV+ +PV H A +A ++ APA SYS Sbjct: 168 APAVVKTVAPVAHYAAPAAYATYAAPTHYAAPAHYAAPAATYTSYS 213 >BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p protein. Length = 205 Score = 76.6 bits (180), Expect = 2e-14 Identities = 42/95 (44%), Positives = 57/95 (60%) Frame = +3 Query: 237 APVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 416 AP+ HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D Sbjct: 20 APIAAPQVYHAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKL 72 Query: 417 TGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 TGD+K Q E RDGDVV+GEYSL+ DG R V+YT Sbjct: 73 TGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYT 107 Score = 33.5 bits (73), Expect = 0.18 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH 305 A VV+ +PV H Sbjct: 168 APAVVKTVAPVAH 180 >AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA protein. Length = 205 Score = 76.6 bits (180), Expect = 2e-14 Identities = 42/95 (44%), Positives = 57/95 (60%) Frame = +3 Query: 237 APVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 416 AP+ HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D Sbjct: 20 APIAAPQVYHAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKL 72 Query: 417 TGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 TGD+K Q E RDGDVV+GEYSL+ DG R V+YT Sbjct: 73 TGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYT 107 Score = 33.5 bits (73), Expect = 0.18 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH 305 A VV+ +PV H Sbjct: 168 APAVVKTVAPVAH 180 >AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle protein protein. Length = 205 Score = 76.6 bits (180), Expect = 2e-14 Identities = 42/95 (44%), Positives = 57/95 (60%) Frame = +3 Query: 237 APVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 416 AP+ HA+P V ++ HAPV A + V+ ++ + H +Y FSY V+D Sbjct: 20 APIAAPQVYHAAPAVATYA---HAPVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKL 72 Query: 417 TGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 TGD+K Q E RDGDVV+GEYSL+ DG R V+YT Sbjct: 73 TGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYT 107 Score = 33.5 bits (73), Expect = 0.18 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH 305 A VV+ +PV H Sbjct: 168 APAVVKTVAPVAH 180 >BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p protein. Length = 424 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 4/66 (6%) Frame = +3 Query: 336 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 503 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 Query: 504 RKVEYT 521 R V YT Sbjct: 96 RTVHYT 101 >BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p protein. Length = 424 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 4/66 (6%) Frame = +3 Query: 336 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 503 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 Query: 504 RKVEYT 521 R V YT Sbjct: 96 RTVHYT 101 >BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p protein. Length = 424 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 4/66 (6%) Frame = +3 Query: 336 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 503 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 Query: 504 RKVEYT 521 R V YT Sbjct: 96 RTVHYT 101 >BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p protein. Length = 424 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 4/66 (6%) Frame = +3 Query: 336 IAVEHSDHVEDHAP----AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 503 + ++ D ++AP Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSI Sbjct: 36 VVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95 Query: 504 RKVEYT 521 R V YT Sbjct: 96 RTVHYT 101 >BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p protein. Length = 136 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = +3 Query: 324 AAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 503 AA+P+ V + V+ H +Y F+Y+V+D TGD KSQ E RDGDVVKG YS++ DGS+ Sbjct: 40 AAVPVGVPLNTEVDPHP--QYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSL 97 Query: 504 RKVEYT 521 R V YT Sbjct: 98 RTVFYT 103 >AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA protein. Length = 147 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = +3 Query: 324 AAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI 503 AA+P+ V + V+ H +Y F+Y+V+D TGD KSQ E RDGDVVKG YS++ DGS+ Sbjct: 51 AAVPVGVPLNTEVDPHP--QYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSL 108 Query: 504 RKVEYT 521 R V YT Sbjct: 109 RTVFYT 114 >BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p protein. Length = 340 Score = 73.7 bits (173), Expect = 1e-13 Identities = 55/130 (42%), Positives = 65/130 (50%), Gaps = 2/130 (1%) Frame = +3 Query: 138 QATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFS--PVQHAP 311 QA Y AAPV T + L P+V A + A+PVV+ + PV AP Sbjct: 56 QAAPVYAKTFVPAAPVYTRSYAL---PTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAP 112 Query: 312 VVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQP 491 VV A AV VE + +Y+FSY V D TGD KSQ ETRDG V G YS+L Sbjct: 113 VVKTVAAAPAV--LKQVELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDA 170 Query: 492 DGSIRKVEYT 521 DG R V YT Sbjct: 171 DGFKRTVTYT 180 >AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-PA protein. Length = 340 Score = 73.7 bits (173), Expect = 1e-13 Identities = 55/130 (42%), Positives = 65/130 (50%), Gaps = 2/130 (1%) Frame = +3 Query: 138 QATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFS--PVQHAP 311 QA Y AAPV T + L P+V A + A+PVV+ + PV AP Sbjct: 56 QAAPVYAKTFVPAAPVYTRSYAL---PTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAP 112 Query: 312 VVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQP 491 VV A AV VE + +Y+FSY V D TGD KSQ ETRDG V G YS+L Sbjct: 113 VVKTVAAAPAV--LKQVELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDA 170 Query: 492 DGSIRKVEYT 521 DG R V YT Sbjct: 171 DGFKRTVTYT 180 >AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-PA protein. Length = 146 Score = 73.7 bits (173), Expect = 1e-13 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = +3 Query: 315 VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPD 494 ++H+ I VE APA Y+F+YSV D HTGD KSQ E+R GD V+G+Y+L+ D Sbjct: 22 IYHSPAAIVKPLLKTVEVEAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDAD 81 Query: 495 GSIRKVEYT 521 G +R V+YT Sbjct: 82 GYLRTVDYT 90 >AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA protein. Length = 145 Score = 73.3 bits (172), Expect = 2e-13 Identities = 37/86 (43%), Positives = 54/86 (62%) Frame = +3 Query: 264 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 443 HA+PV + +P A V+ A P+ + + + H +Y+++Y V+D +GD KSQ E Sbjct: 27 HAAPVATYAAPAP-AAVLKTVAQPVLAKADEEYDPHP--QYKYAYDVQDAISGDSKSQVE 83 Query: 444 TRDGDVVKGEYSLLQPDGSIRKVEYT 521 RDGDVV+GEYSL+ DG R V+YT Sbjct: 84 ERDGDVVRGEYSLVDSDGFKRTVQYT 109 >AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB protein. Length = 401 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +3 Query: 384 YEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 Y FSY V+D HTGD KSQ E+RDGD VKG YS+L+PDGSIR V YT Sbjct: 33 YAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYT 78 >BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p protein. Length = 245 Score = 72.1 bits (169), Expect = 4e-13 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 KY F Y ++D +TGD KSQHETR GDVVKG YS++ PDG+ R V+YT Sbjct: 67 KYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYT 113 Score = 29.1 bits (62), Expect(2) = 0.074 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 108 SIVRHDEPSHQATAHYTPVLSHA-APVLTHAAPLIQHAGPIVHAAPV 245 ++VR + +++A AH PV++ A APV H P P V AP+ Sbjct: 122 AVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPL 168 Score = 24.6 bits (51), Expect(2) = 0.074 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 234 AAPVEHSSYIHAS-PVVQHFSPVQHAPVVHHAAIPI 338 A PV S++ HA+ P + H SP H P A P+ Sbjct: 203 ATPVLPSAHFHAAYPALAH-SPYAHYPAPGPAPAPV 237 >BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p protein. Length = 245 Score = 72.1 bits (169), Expect = 4e-13 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 KY F Y ++D +TGD KSQHETR GDVVKG YS++ PDG+ R V+YT Sbjct: 67 KYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYT 113 Score = 29.1 bits (62), Expect(2) = 0.074 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 108 SIVRHDEPSHQATAHYTPVLSHA-APVLTHAAPLIQHAGPIVHAAPV 245 ++VR + +++A AH PV++ A APV H P P V AP+ Sbjct: 122 AVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPL 168 Score = 24.6 bits (51), Expect(2) = 0.074 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 234 AAPVEHSSYIHAS-PVVQHFSPVQHAPVVHHAAIPI 338 A PV S++ HA+ P + H SP H P A P+ Sbjct: 203 ATPVLPSAHFHAAYPALAH-SPYAHYPAPGPAPAPV 237 >AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA protein. Length = 245 Score = 72.1 bits (169), Expect = 4e-13 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 KY F Y ++D +TGD KSQHETR GDVVKG YS++ PDG+ R V+YT Sbjct: 67 KYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYT 113 Score = 29.1 bits (62), Expect(2) = 0.074 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 108 SIVRHDEPSHQATAHYTPVLSHA-APVLTHAAPLIQHAGPIVHAAPV 245 ++VR + +++A AH PV++ A APV H P P V AP+ Sbjct: 122 AVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPL 168 Score = 24.6 bits (51), Expect(2) = 0.074 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 234 AAPVEHSSYIHAS-PVVQHFSPVQHAPVVHHAAIPI 338 A PV S++ HA+ P + H SP H P A P+ Sbjct: 203 ATPVLPSAHFHAAYPALAH-SPYAHYPAPGPAPAPV 237 >AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.7 bits (168), Expect = 5e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQEHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.7 bits (168), Expect = 5e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQEHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.7 bits (168), Expect = 5e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQEHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.7 bits (168), Expect = 5e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQEHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA protein. Length = 199 Score = 71.7 bits (168), Expect = 5e-13 Identities = 37/86 (43%), Positives = 54/86 (62%) Frame = +3 Query: 264 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 443 HA+P V ++ APV A P+ + ++ + H +Y+++Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLAKAAEEYDPHP--QYKYAYDVQDSLSGDSKSQVE 81 Query: 444 TRDGDVVKGEYSLLQPDGSIRKVEYT 521 RDGDVV+GEYSL+ DG R V+YT Sbjct: 82 ERDGDVVRGEYSLIDADGYKRTVQYT 107 Score = 35.9 bits (79), Expect = 0.033 Identities = 33/92 (35%), Positives = 47/92 (51%), Gaps = 7/92 (7%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH--APVVH--HAAIPIAVEH 350 A VV+ +PV H AP + +AA +A H Sbjct: 168 APAVVKTVAPVAHYAAPATYTSYAAPAVAYHH 199 >AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle protein protein. Length = 199 Score = 71.7 bits (168), Expect = 5e-13 Identities = 37/86 (43%), Positives = 54/86 (62%) Frame = +3 Query: 264 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 443 HA+P V ++ APV A P+ + ++ + H +Y+++Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLAKAAEEYDPHP--QYKYAYDVQDSLSGDSKSQVE 81 Query: 444 TRDGDVVKGEYSLLQPDGSIRKVEYT 521 RDGDVV+GEYSL+ DG R V+YT Sbjct: 82 ERDGDVVRGEYSLIDADGYKRTVQYT 107 Score = 35.9 bits (79), Expect = 0.033 Identities = 33/92 (35%), Positives = 47/92 (51%), Gaps = 7/92 (7%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH--APVVH--HAAIPIAVEH 350 A VV+ +PV H AP + +AA +A H Sbjct: 168 APAVVKTVAPVAHYAAPATYTSYAAPAVAYHH 199 >AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p protein. Length = 221 Score = 71.3 bits (167), Expect = 7e-13 Identities = 40/95 (42%), Positives = 55/95 (57%) Frame = +3 Query: 237 APVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPH 416 AP+ HA+P V ++ HA V A + V+ ++ + H +Y FSY V+D Sbjct: 20 APIAAPQVYHAAPAVATYA---HATVA--VAQKVVVKAAEEYDPHP--QYRFSYGVDDKL 72 Query: 417 TGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 TGD+K Q E R GDVV+GEYSL+ DG R V+YT Sbjct: 73 TGDNKGQVEERGGDVVRGEYSLIDADGYKRTVQYT 107 Score = 36.3 bits (80), Expect = 0.025 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 4/106 (3%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQH-AGPIV--HAAPVEHSSYIH 266 ++ + V + EP +A A V + AAPV +AAP + H A P V APV H + Sbjct: 111 INGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYA--- 167 Query: 267 ASPVVQHFSPVQH-APVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS 401 A VV+ +PV H A +A ++ APA SYS Sbjct: 168 APAVVKTVAPVAHYAAPAAYATYAAPTHYAAPAHYAAPAATYTSYS 213 >AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHR---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA protein. Length = 204 Score = 71.3 bits (167), Expect = 7e-13 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V A H+ Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKA--------HSWG 66 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 VQ Q APV H + + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 67 TVQDHHHQQWAPVAAHDSHH---QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA protein. Length = 151 Score = 70.9 bits (166), Expect = 1e-12 Identities = 38/86 (44%), Positives = 53/86 (61%) Frame = +3 Query: 264 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 443 HA+P V ++ APV A P+ + ++ + H +Y+F+Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLTKATEEYDPHP--QYKFAYDVQDSLSGDSKSQVE 81 Query: 444 TRDGDVVKGEYSLLQPDGSIRKVEYT 521 RDGDVV GEYSL+ DG R V+YT Sbjct: 82 ERDGDVVHGEYSLIDSDGYKRIVQYT 107 >AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle protein protein. Length = 151 Score = 70.9 bits (166), Expect = 1e-12 Identities = 38/86 (44%), Positives = 53/86 (61%) Frame = +3 Query: 264 HASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHE 443 HA+P V ++ APV A P+ + ++ + H +Y+F+Y V+D +GD KSQ E Sbjct: 27 HAAPAVATYA---QAPVAVAHAQPVLTKATEEYDPHP--QYKFAYDVQDSLSGDSKSQVE 81 Query: 444 TRDGDVVKGEYSLLQPDGSIRKVEYT 521 RDGDVV GEYSL+ DG R V+YT Sbjct: 82 ERDGDVVHGEYSLIDSDGYKRIVQYT 107 >AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 69.3 bits (162), Expect = 3e-12 Identities = 52/142 (36%), Positives = 65/142 (45%) Frame = +3 Query: 96 VSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASP 275 V++ S + H SH+ Y+ H AP H V P HS Sbjct: 15 VAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDV---PKAHSWGTDQDH 71 Query: 276 VVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDG 455 Q ++PV A HH + S H E KYEF+Y V+D TGD K Q ETRDG Sbjct: 72 HHQQWAPVA-AHDSHH-------QWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDG 123 Query: 456 DVVKGEYSLLQPDGSIRKVEYT 521 D VKG Y++ + DG R VEYT Sbjct: 124 DKVKGGYTMKEADGRTRIVEYT 145 >AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p protein. Length = 302 Score = 68.5 bits (160), Expect = 5e-12 Identities = 43/130 (33%), Positives = 63/130 (48%) Frame = +3 Query: 132 SHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAP 311 S A+ + +L +AA + L+ P++ ++S + ++ Q VQH Sbjct: 76 SRTASVQASNLLQNAASAANAESVLLPSPLPVLRHE--QNSEVVSSTQQQQEQQTVQHQQ 133 Query: 312 VVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQP 491 + +H + E PA Y F+Y+V D TGD K ETRDG VV+G YSL+ P Sbjct: 134 SEPLVVSSVLRQHQEP-EVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDP 192 Query: 492 DGSIRKVEYT 521 DG R V YT Sbjct: 193 DGYKRTVTYT 202 >AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA protein. Length = 302 Score = 68.5 bits (160), Expect = 5e-12 Identities = 43/130 (33%), Positives = 63/130 (48%) Frame = +3 Query: 132 SHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAP 311 S A+ + +L +AA + L+ P++ ++S + ++ Q VQH Sbjct: 76 SRTASVQASNLLQNAASAANAESVLLPSPLPVLRHE--QNSEVVSSTQQQQEQQTVQHQQ 133 Query: 312 VVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQP 491 + +H + E PA Y F+Y+V D TGD K ETRDG VV+G YSL+ P Sbjct: 134 SEPLVVSSVLRQHQEP-EVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDP 192 Query: 492 DGSIRKVEYT 521 DG R V YT Sbjct: 193 DGYKRTVTYT 202 >Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystallin protein. Length = 472 Score = 67.3 bits (157), Expect = 1e-11 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 +Y F+Y V D TGD K Q E RDGD+VKG+YSL++PDG+ R VEYT Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122 >AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p protein. Length = 477 Score = 67.3 bits (157), Expect = 1e-11 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 +Y F+Y V D TGD K Q E RDGD+VKG+YSL++PDG+ R VEYT Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122 >AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-PA protein. Length = 477 Score = 67.3 bits (157), Expect = 1e-11 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 +Y F+Y V D TGD K Q E RDGD+VKG+YSL++PDG+ R VEYT Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYT 122 >M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protein protein. Length = 188 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = +3 Query: 330 IPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRK 509 +P S+ D P +Y F+Y V+DP TGD KSQ E+RDGDVV G+YS+ DG R Sbjct: 20 LPAKSSGSEDTYDSHP-QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRT 78 Query: 510 VEYT 521 V+YT Sbjct: 79 VDYT 82 Score = 34.3 bits (75), Expect = 0.10 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +3 Query: 186 LTHAAPLIQHA-GPIVHAAPVEHSSYIHASPV---VQHFSPVQHAPVVHHAAIPIAVEH 350 L+ A+ ++ + P+VH APV H + HA+P V H PV VHHA P A+ + Sbjct: 130 LSQASAVVHRSFAPVVHHAPVTHVVH-HAAPAHSFVSHHVPVLKT-TVHHAHHPHAISY 186 >AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA protein. Length = 188 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = +3 Query: 330 IPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRK 509 +P S+ D P +Y F+Y V+DP TGD KSQ E+RDGDVV G+YS+ DG R Sbjct: 20 LPAKSSGSEDTYDSHP-QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRT 78 Query: 510 VEYT 521 V+YT Sbjct: 79 VDYT 82 Score = 34.3 bits (75), Expect = 0.10 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +3 Query: 186 LTHAAPLIQHA-GPIVHAAPVEHSSYIHASPV---VQHFSPVQHAPVVHHAAIPIAVEH 350 L+ A+ ++ + P+VH APV H + HA+P V H PV VHHA P A+ + Sbjct: 130 LSQASAVVHRSFAPVVHHAPVTHVVH-HAAPAHSFVSHHVPVLKT-TVHHAHHPHAISY 186 >AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cuticle-protein protein. Length = 188 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = +3 Query: 330 IPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRK 509 +P S+ D P +Y F+Y V+DP TGD KSQ E+RDGDVV G+YS+ DG R Sbjct: 20 LPAKSSGSEDTYDSHP-QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRT 78 Query: 510 VEYT 521 V+YT Sbjct: 79 VDYT 82 Score = 34.3 bits (75), Expect = 0.10 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +3 Query: 186 LTHAAPLIQHA-GPIVHAAPVEHSSYIHASPV---VQHFSPVQHAPVVHHAAIPIAVEH 350 L+ A+ ++ + P+VH APV H + HA+P V H PV VHHA P A+ + Sbjct: 130 LSQASAVVHRSFAPVVHHAPVTHVVH-HAAPAHSFVSHHVPVLKT-TVHHAHHPHAISY 186 >AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p protein. Length = 192 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/71 (46%), Positives = 42/71 (59%) Frame = +3 Query: 309 PVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQ 488 P + A P+ + + +Y FSY V D TGD KSQ ETR GDVV+G YSL++ Sbjct: 35 PALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIE 94 Query: 489 PDGSIRKVEYT 521 DG+ R VEYT Sbjct: 95 ADGTRRIVEYT 105 >AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA protein. Length = 192 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/71 (46%), Positives = 42/71 (59%) Frame = +3 Query: 309 PVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQ 488 P + A P+ + + +Y FSY V D TGD KSQ ETR GDVV+G YSL++ Sbjct: 35 PALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIE 94 Query: 489 PDGSIRKVEYT 521 DG+ R VEYT Sbjct: 95 ADGTRRIVEYT 105 >AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-PA, isoform A protein. Length = 146 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/62 (51%), Positives = 39/62 (62%) Frame = +3 Query: 336 IAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVE 515 I H D + +PA+YEF YSV D H+GD K Q E R G+ V G YSL+ PDG R V+ Sbjct: 67 IIASHPDELIA-SPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVD 125 Query: 516 YT 521 YT Sbjct: 126 YT 127 >AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-PB, isoform B protein. Length = 106 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/62 (51%), Positives = 39/62 (62%) Frame = +3 Query: 336 IAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVE 515 I H D + +PA+YEF YSV D H+GD K Q E R G+ V G YSL+ PDG R V+ Sbjct: 27 IIASHPDELIA-SPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVD 85 Query: 516 YT 521 YT Sbjct: 86 YT 87 >AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA protein. Length = 217 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 H + +D P KY F+Y V+D +GD KSQ E+RDGDVV+GEYSL DG R V+YT Sbjct: 54 HEVYPDDPHP-KYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYT 110 >AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle protein protein. Length = 217 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 H + +D P KY F+Y V+D +GD KSQ E+RDGDVV+GEYSL DG R V+YT Sbjct: 54 HEVYPDDPHP-KYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYT 110 >AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p protein. Length = 208 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +3 Query: 306 APV-VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSL 482 APV V A +P+ + + E +Y +SY V+D +GD+K E RDGDVV+GEYSL Sbjct: 24 APVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSL 83 Query: 483 LQPDGSIRKVEYT 521 + DG R V YT Sbjct: 84 IDADGFKRTVTYT 96 >AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA protein. Length = 208 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +3 Query: 306 APV-VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSL 482 APV V A +P+ + + E +Y +SY V+D +GD+K E RDGDVV+GEYSL Sbjct: 24 APVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSL 83 Query: 483 LQPDGSIRKVEYT 521 + DG R V YT Sbjct: 84 IDADGFKRTVTYT 96 >AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA protein. Length = 218 Score = 62.9 bits (146), Expect = 3e-10 Identities = 40/109 (36%), Positives = 49/109 (44%) Frame = +3 Query: 195 AAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHA 374 AAP H H H+S +H + H HH H DH + HA Sbjct: 19 AAPFHGHEHHGHHGGATSHAS-VHLTSHDDHHEEHHGHHHDHHG-------HDDHHDSHA 70 Query: 375 PAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 +Y+F Y V+D TGD KSQ E+R G V G Y L+ DG R V YT Sbjct: 71 --EYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYT 117 >AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA protein. Length = 153 Score = 62.9 bits (146), Expect = 3e-10 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +3 Query: 366 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 D+ P YEF +SV DPHTGD KSQ E+R D V+G Y L+ DG R V+Y Sbjct: 27 DYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQY 77 >AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle protein protein. Length = 208 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +3 Query: 306 APV-VHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSL 482 APV V A +P+ + + E +Y +SY V+D +GD+K E RDGDVV+GEYSL Sbjct: 24 APVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSL 83 Query: 483 LQPDGSIRKVEYT 521 + DG R V YT Sbjct: 84 IDADGFKRTVTYT 96 >AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p protein. Length = 206 Score = 59.3 bits (137), Expect = 3e-09 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = +3 Query: 324 AAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 500 AA P+A VE++ P +Y + Y V+D +GD K+Q ETR+GDVV+G+YSL DG Sbjct: 38 AAAPLAAVAQ--VEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGY 95 Query: 501 IRKVEYT 521 R V+YT Sbjct: 96 RRIVDYT 102 >AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA protein. Length = 191 Score = 59.3 bits (137), Expect = 3e-09 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = +3 Query: 324 AAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 500 AA P+A VE++ P +Y + Y V+D +GD K+Q ETR+GDVV+G+YSL DG Sbjct: 23 AAAPLAAVAQ--VEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGY 80 Query: 501 IRKVEYT 521 R V+YT Sbjct: 81 RRIVDYT 87 >AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle protein protein. Length = 191 Score = 59.3 bits (137), Expect = 3e-09 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = +3 Query: 324 AAIPIAVEHSDHVEDHAP-AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGS 500 AA P+A VE++ P +Y + Y V+D +GD K+Q ETR+GDVV+G+YSL DG Sbjct: 23 AAAPLAAVAQ--VEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGY 80 Query: 501 IRKVEYT 521 R V+YT Sbjct: 81 RRIVDYT 87 >AY071231-1|AAL48853.1| 217|Drosophila melanogaster RE26879p protein. Length = 217 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = +3 Query: 363 EDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 E + PAKYEF Y V+D +G+ E+RDGD+ G Y +L PDG + VEY Sbjct: 121 EQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEY 172 >AE013599-2993|AAF57484.2| 217|Drosophila melanogaster CG9036-PA protein. Length = 217 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = +3 Query: 363 EDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 E + PAKYEF Y V+D +G+ E+RDGD+ G Y +L PDG + VEY Sbjct: 121 EQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEY 172 >BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p protein. Length = 266 Score = 55.2 bits (127), Expect = 5e-08 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +3 Query: 348 HSDHVEDH-APAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 H D+ A +Y F+Y VED T +++ ETR+GD V+G YS++ PDG++R V+YT Sbjct: 90 HDGRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYT 148 >AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-PA protein. Length = 266 Score = 55.2 bits (127), Expect = 5e-08 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +3 Query: 348 HSDHVEDH-APAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 H D+ A +Y F+Y VED T +++ ETR+GD V+G YS++ PDG++R V+YT Sbjct: 90 HDGRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYT 148 >AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-PA, isoform A protein. Length = 620 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = +3 Query: 363 EDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 ++ PAKYEF+Y VED +G E RDGD G+Y++L PDG + VEY Sbjct: 338 DNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEY 389 >AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p protein. Length = 178 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 354 DHVEDHAPAK-YEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 DHV H P Y+F Y+V+DP T + + + DGDVV GEY + PDG + V YT Sbjct: 81 DHV--HVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYT 135 >AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA protein. Length = 178 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 354 DHVEDHAPAK-YEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 DHV H P Y+F Y+V+DP T + + + DGDVV GEY + PDG + V YT Sbjct: 81 DHV--HVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYT 135 >AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p protein. Length = 270 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/59 (35%), Positives = 37/59 (62%) Frame = +3 Query: 345 EHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 ++ + D + Y+F + V+D +++++ E RDG V+KG YS++ DG IR V+YT Sbjct: 145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYT 203 >AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-PA protein. Length = 270 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/59 (35%), Positives = 37/59 (62%) Frame = +3 Query: 345 EHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 ++ + D + Y+F + V+D +++++ E RDG V+KG YS++ DG IR V+YT Sbjct: 145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYT 203 >AY071377-1|AAL48999.1| 131|Drosophila melanogaster RE40431p protein. Length = 131 Score = 50.8 bits (116), Expect = 1e-06 Identities = 39/93 (41%), Positives = 53/93 (56%), Gaps = 7/93 (7%) Frame = +3 Query: 93 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSY 260 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV HS Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPVVHS-- 99 Query: 261 IHASPVVQ---HFSPVQHAPVVHHAAIPIAVEH 350 +H++PVV H +P+ + VVH A + + H Sbjct: 100 VHSAPVVHSVLHSAPLVKS-VVHSAPLAYTLHH 131 Score = 37.1 bits (82), Expect = 0.014 Identities = 34/113 (30%), Positives = 54/113 (47%) Frame = +3 Query: 15 MFFKIAVVCSILAICQGGVIDEGHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTH 194 MF I V+ ++A G+I E H H V + + H A + +SH + H Sbjct: 1 MFKFIGVIALLVATASAGLI-ETH-HVVHEPVLAKVGSVVHSAPS----AVSHQSITQVH 54 Query: 195 AAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHS 353 + ++Q P+V A V+ ++Y H + V H +PV H+ V HAA + HS Sbjct: 55 SKAVVQ---PVV-APIVKTTTYSHPAVAV-HAAPVVHSVPVVHAAPVVHSVHS 102 >AE014296-2696|AAF49492.1| 131|Drosophila melanogaster CG13060-PA protein. Length = 131 Score = 50.8 bits (116), Expect = 1e-06 Identities = 39/93 (41%), Positives = 53/93 (56%), Gaps = 7/93 (7%) Frame = +3 Query: 93 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSY 260 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV HS Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPVVHS-- 99 Query: 261 IHASPVVQ---HFSPVQHAPVVHHAAIPIAVEH 350 +H++PVV H +P+ + VVH A + + H Sbjct: 100 VHSAPVVHSVLHSAPLVKS-VVHSAPLAYTLHH 131 Score = 37.1 bits (82), Expect = 0.014 Identities = 34/113 (30%), Positives = 54/113 (47%) Frame = +3 Query: 15 MFFKIAVVCSILAICQGGVIDEGHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTH 194 MF I V+ ++A G+I E H H V + + H A + +SH + H Sbjct: 1 MFKFIGVIALLVATASAGLI-ETH-HVVHEPVLAKVGSVVHSAPS----AVSHQSITQVH 54 Query: 195 AAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHS 353 + ++Q P+V A V+ ++Y H + V H +PV H+ V HAA + HS Sbjct: 55 SKAVVQ---PVV-APIVKTTTYSHPAVAV-HAAPVVHSVPVVHAAPVVHSVHS 102 >AY071564-1|AAL49186.1| 124|Drosophila melanogaster RE63063p protein. Length = 124 Score = 46.8 bits (106), Expect = 2e-05 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 9/122 (7%) Frame = +3 Query: 15 MFFKIAVVCSILAICQGGVIDEGHG-H--AVSSQSIVRHDEPSHQATAHYTPVLSHAAPV 185 MF +AV+ ++A G+I+ H H ++ V H PS + T V S A V Sbjct: 1 MFKFVAVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAV-V 59 Query: 186 LTHAAPLIQ-----HAGPIVHAAPVEHSSYIHASPVVQHFSPVQHA-PVVHHAAIPIAVE 347 AP+++ H VHAAPV +H+ PVV H +PV H+ P+VH A + +V Sbjct: 60 QPVVAPIVKTTTYSHPAVAVHAAPV-----VHSVPVV-HAAPVVHSVPLVHSAPLVKSVV 113 Query: 348 HS 353 HS Sbjct: 114 HS 115 Score = 46.8 bits (106), Expect = 2e-05 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 5/81 (6%) Frame = +3 Query: 93 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHS-S 257 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV HS Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPVVHSVP 101 Query: 258 YIHASPVVQHFSPVQHAPVVH 320 +H++P+V+ S V AP+ + Sbjct: 102 LVHSAPLVK--SVVHSAPLAY 120 >AE014296-2695|AAF49493.1| 124|Drosophila melanogaster CG13041-PA protein. Length = 124 Score = 46.8 bits (106), Expect = 2e-05 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 9/122 (7%) Frame = +3 Query: 15 MFFKIAVVCSILAICQGGVIDEGHG-H--AVSSQSIVRHDEPSHQATAHYTPVLSHAAPV 185 MF +AV+ ++A G+I+ H H ++ V H PS + T V S A V Sbjct: 1 MFKFVAVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAV-V 59 Query: 186 LTHAAPLIQ-----HAGPIVHAAPVEHSSYIHASPVVQHFSPVQHA-PVVHHAAIPIAVE 347 AP+++ H VHAAPV +H+ PVV H +PV H+ P+VH A + +V Sbjct: 60 QPVVAPIVKTTTYSHPAVAVHAAPV-----VHSVPVV-HAAPVVHSVPLVHSAPLVKSVV 113 Query: 348 HS 353 HS Sbjct: 114 HS 115 Score = 46.8 bits (106), Expect = 2e-05 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 5/81 (6%) Frame = +3 Query: 93 AVSSQSIVR-HDEPSHQ---ATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHS-S 257 AVS QSI + H + Q A T SH A V HAAP++ H+ P+VHAAPV HS Sbjct: 44 AVSHQSITQVHSKAVVQPVVAPIVKTTTYSHPA-VAVHAAPVV-HSVPVVHAAPVVHSVP 101 Query: 258 YIHASPVVQHFSPVQHAPVVH 320 +H++P+V+ S V AP+ + Sbjct: 102 LVHSAPLVK--SVVHSAPLAY 120 >AY071448-1|AAL49070.1| 815|Drosophila melanogaster RE53044p protein. Length = 815 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 378 AKYEFSYSVEDPHTGDHKSQHETRD-GDVVKGEYSLLQPDGSIRKVEY 518 +KYEF Y + D HTG+ + RD V +G+Y +L PDG I+ V Y Sbjct: 749 SKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIY 796 >AM294624-1|CAL26622.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 46.0 bits (104), Expect = 3e-05 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = +3 Query: 285 HFSPVQHAPVVHHAAIPIAVE-HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDG 455 H + QH P H +E +SD+ +H + +S Y + D + H E R+G Sbjct: 23 HIAHTQHGPAGH-------IEFYSDYGRNHDEERLHYSHQYHISDVASRVHILHQEQRNG 75 Query: 456 DVVKGEYSLLQPDGSIRKVEY 518 D V G YS L+P G IR V Y Sbjct: 76 DYVSGSYSHLEPSGHIRSVHY 96 >AE013599-1762|AAF58339.2| 815|Drosophila melanogaster CG13338-PA protein. Length = 815 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 378 AKYEFSYSVEDPHTGDHKSQHETRD-GDVVKGEYSLLQPDGSIRKVEY 518 +KYEF Y + D HTG+ + RD V +G+Y +L PDG I+ V Y Sbjct: 749 SKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIY 796 >AE014296-2698|AAF49490.1| 185|Drosophila melanogaster CG13040-PA protein. Length = 185 Score = 45.2 bits (102), Expect = 5e-05 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 14/110 (12%) Frame = +3 Query: 84 HGHAVSSQSIVRHDEPSH---QATAHYTPVLSHAAPVLTHAAPLIQHAGPIV----HAAP 242 H AV + +V+H P+ + A PV+ H AP++ P+++ PIV H AP Sbjct: 55 HNQAVLTP-VVKHVVPAVPVIKTVAPVVPVVKHVAPIV----PVVKQVAPIVPVVKHVAP 109 Query: 243 VEHSSYIHASPVVQHFSPVQHAPVVHH-AAIPI------AVEHSDHVEDH 371 V I PVV H + V AP VHH AA+P+ AV H H + H Sbjct: 110 V--VPVIKTVPVVHHQTYV--APAVHHVAAVPVVKALPHAVSHQSHTQVH 155 >AM294629-1|CAL26627.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AM294628-1|CAL26626.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AM294627-1|CAL26625.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AM294626-1|CAL26624.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AM294623-1|CAL26621.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AM294621-1|CAL26619.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 +SD+ +H + +S Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AE014296-369|AAF47578.1| 143|Drosophila melanogaster CG13934-PA protein. Length = 143 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +3 Query: 348 HSDHVEDHAPAKYEFS--YSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 +SD+ +H + +S Y + D + H E R GD V G YS L+P G IR V Y Sbjct: 38 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHY 96 >AM294630-1|CAL26628.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +3 Query: 366 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 D Y Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 46 DEERLHYSHQYHISDAASRVHILHREQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AM294625-1|CAL26623.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +3 Query: 366 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 D Y Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 46 DEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AM294622-1|CAL26620.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = +3 Query: 366 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 D Y Y + D + H E R+GD V G YS L+P G IR V Y Sbjct: 46 DEERLHYSHQYHISDVASRVHILHQEQRNGDYVSGSYSHLEPSGHIRSVHY 96 >AY070701-1|AAL48172.1| 95|Drosophila melanogaster RH37844p protein. Length = 95 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/68 (39%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +3 Query: 138 QATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVV 317 QA AH P + APV+ H P + H I H A HS +H V+ +PV H PVV Sbjct: 15 QAIAH--PGVVAVAPVVAH--PAVVHTPIIHHGAHSVHSHVVHHPAAVKVITPVVHKPVV 70 Query: 318 H-HAAIPI 338 HA P+ Sbjct: 71 AVHAVRPV 78 >AE014297-2974|AAF55879.1| 95|Drosophila melanogaster CG17298-PA protein. Length = 95 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/68 (39%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +3 Query: 138 QATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVV 317 QA AH P + APV+ H P + H I H A HS +H V+ +PV H PVV Sbjct: 15 QAIAH--PGVVAVAPVVAH--PAVVHTPIIHHGAHSVHSHVVHHPAAVKVITPVVHKPVV 70 Query: 318 H-HAAIPI 338 HA P+ Sbjct: 71 AVHAVRPV 78 >BT023021-1|AAY55437.1| 133|Drosophila melanogaster IP04071p protein. Length = 133 Score = 41.1 bits (92), Expect = 9e-04 Identities = 20/51 (39%), Positives = 23/51 (45%) Frame = +3 Query: 366 DHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 D Y Y + D + H E R GD V G YS L+P G IR V Y Sbjct: 36 DEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHY 86 >AY084169-1|AAL89907.1| 123|Drosophila melanogaster RE40783p protein. Length = 123 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 17/103 (16%) Frame = +3 Query: 15 MFFKIAVVCSILAICQGGVIDE-GHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLT 191 MF IA++ ++ A+ GVI HG+ + + + + +H + S+AAP++ Sbjct: 1 MFKLIALISALCAVANAGVISPYSHGYGLGYGAALAPAYAAPAVISHAPIIKSYAAPIVA 60 Query: 192 H---------------AAPLIQHAGPIVHAAPVEHS-SYIHAS 272 H A P++ HA P+VHA P HS S H S Sbjct: 61 HPVATSYANTYKVATKAIPVV-HAAPLVHAVPALHSTSTYHGS 102 >AE014296-2686|AAF49501.1| 123|Drosophila melanogaster CG4962-PA protein. Length = 123 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 17/103 (16%) Frame = +3 Query: 15 MFFKIAVVCSILAICQGGVIDE-GHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLT 191 MF IA++ ++ A+ GVI HG+ + + + + +H + S+AAP++ Sbjct: 1 MFKLIALISALCAVANAGVISPYSHGYGLGYGAALAPAYAAPAVISHAPIIKSYAAPIVA 60 Query: 192 H---------------AAPLIQHAGPIVHAAPVEHS-SYIHAS 272 H A P++ HA P+VHA P HS S H S Sbjct: 61 HPVATSYANTYKVATKAIPVV-HAAPLVHAVPALHSTSTYHGS 102 >BT024391-1|ABC86453.1| 144|Drosophila melanogaster IP05345p protein. Length = 144 Score = 38.3 bits (85), Expect = 0.006 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 8/72 (11%) Frame = +3 Query: 102 SQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAA--PLIQHA---GPIVH---AAPVEHSS 257 SQS+V H SH PV+ + PV+++AA P++ A P+VH AAPV H+S Sbjct: 75 SQSVV-HSH-SHVVEDIVAPVVK-STPVVSYAAAAPVVHTAYAAAPVVHTSYAAPVVHTS 131 Query: 258 YIHASPVVQHFS 293 Y ASPVV + S Sbjct: 132 YAAASPVVYNSS 143 >AE014296-2690|AAF49497.1| 129|Drosophila melanogaster CG13063-PA protein. Length = 129 Score = 38.3 bits (85), Expect = 0.006 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 8/72 (11%) Frame = +3 Query: 102 SQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAA--PLIQHA---GPIVH---AAPVEHSS 257 SQS+V H SH PV+ + PV+++AA P++ A P+VH AAPV H+S Sbjct: 60 SQSVV-HSH-SHVVEDIVAPVVK-STPVVSYAAAAPVVHTAYAAAPVVHTSYAAPVVHTS 116 Query: 258 YIHASPVVQHFS 293 Y ASPVV + S Sbjct: 117 YAAASPVVYNSS 128 >AE013599-1213|AAF58716.1| 100|Drosophila melanogaster CG13231-PA protein. Length = 100 Score = 38.3 bits (85), Expect = 0.006 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Frame = +3 Query: 150 HYTPVLSH----AAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVV 317 ++ P+++H AAP L H AP+I HA I HA + H H V + P H+ + Sbjct: 44 YHAPLVTHSHYIAAPTLVHHAPIISHAPLIAHAPLIAH----HPVSSVSYHLPTYHS--I 97 Query: 318 HH 323 HH Sbjct: 98 HH 99 Score = 37.1 bits (82), Expect = 0.014 Identities = 20/56 (35%), Positives = 27/56 (48%) Frame = +3 Query: 231 HAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSY 398 HA V HS YI A +V H + HAP++ HA + IA V H P + + Sbjct: 45 HAPLVTHSHYIAAPTLVHHAPIISHAPLIAHAPL-IAHHPVSSVSYHLPTYHSIHH 99 Score = 34.7 bits (76), Expect = 0.077 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +3 Query: 147 AHY--TPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSY 260 +HY P L H AP+++HA PLI HA P++ PV SY Sbjct: 52 SHYIAAPTLVHHAPIISHA-PLIAHA-PLIAHHPVSSVSY 89 Score = 32.3 bits (70), Expect = 0.41 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +3 Query: 213 HAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEH 350 HA + H+ + + +H +P++ H + HAP++ H + H Sbjct: 45 HAPLVTHSHYIAAPTLVHHAPIISHAPLIAHAPLIAHHPVSSVSYH 90 >AY071687-1|AAL49309.1| 148|Drosophila melanogaster RH10371p protein. Length = 148 Score = 37.9 bits (84), Expect = 0.008 Identities = 36/91 (39%), Positives = 46/91 (50%), Gaps = 6/91 (6%) Frame = +3 Query: 132 SHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVH---AAPVEHSSYIHASPVVQHFSPVQ 302 SHQ+ + V SHA V AP+++ P+V AAPV H+SY A+PVV H S Sbjct: 58 SHQSQS---VVHSHAHVVEDVVAPVVKST-PVVSYAAAAPVVHTSYA-AAPVV-HTSYAA 111 Query: 303 HAPVVH---HAAIPIAVEHSDHVEDHAPAKY 386 APVVH AA P+ V +P Y Sbjct: 112 PAPVVHTSYAAAAPVLATSYAQVAASSPLTY 142 >AE014296-2689|AAF49498.1| 148|Drosophila melanogaster CG13043-PA protein. Length = 148 Score = 37.9 bits (84), Expect = 0.008 Identities = 36/91 (39%), Positives = 46/91 (50%), Gaps = 6/91 (6%) Frame = +3 Query: 132 SHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVH---AAPVEHSSYIHASPVVQHFSPVQ 302 SHQ+ + V SHA V AP+++ P+V AAPV H+SY A+PVV H S Sbjct: 58 SHQSQS---VVHSHAHVVEDVVAPVVKST-PVVSYAAAAPVVHTSYA-AAPVV-HTSYAA 111 Query: 303 HAPVVH---HAAIPIAVEHSDHVEDHAPAKY 386 APVVH AA P+ V +P Y Sbjct: 112 PAPVVHTSYAAAAPVLATSYAQVAASSPLTY 142 >BT023884-1|ABA81818.1| 697|Drosophila melanogaster RE55168p protein. Length = 697 Score = 36.3 bits (80), Expect = 0.025 Identities = 30/106 (28%), Positives = 39/106 (36%), Gaps = 3/106 (2%) Frame = +3 Query: 81 GHGHAVSSQSIVRHDEP---SHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEH 251 GHGH SS H S + AH++ HAA H+ P H+ P H H Sbjct: 56 GHGHHTSSGG--HHGGAGGHSQKQAAHHSTTSGHAAKGQHHSPPSRIHSPPTEH-----H 108 Query: 252 SSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYE 389 ++ QH QH + HH H H P K+E Sbjct: 109 PDHVGHYEYFQH----QHEQIFHHEGANGGASHKQQTHHH-PNKHE 149 >AY070997-1|AAL48619.1| 144|Drosophila melanogaster RE08808p protein. Length = 144 Score = 36.3 bits (80), Expect = 0.025 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 378 AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI-RKVEY 518 A+Y F+ SV+D S++E R+G V+G YS DG + R+VEY Sbjct: 42 AQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEY 87 >AE014296-1307|AAN12047.1| 163|Drosophila melanogaster CG32375-PA protein. Length = 163 Score = 36.3 bits (80), Expect = 0.025 Identities = 30/106 (28%), Positives = 39/106 (36%), Gaps = 3/106 (2%) Frame = +3 Query: 81 GHGHAVSSQSIVRHDEP---SHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEH 251 GHGH SS H S + AH++ HAA H+ P H+ P H H Sbjct: 56 GHGHHTSSGG--HHGGAGGHSQKQAAHHSTTSGHAAKGQHHSPPSRIHSPPTEH-----H 108 Query: 252 SSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYE 389 ++ QH QH + HH H H P K+E Sbjct: 109 PDHVGHYEYFQH----QHEQIFHHEGANGGASHKQQTHHH-PNKHE 149 >AE013599-1904|AAF58238.1| 144|Drosophila melanogaster CG10112-PA protein. Length = 144 Score = 36.3 bits (80), Expect = 0.025 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 378 AKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSI-RKVEY 518 A+Y F+ SV+D S++E R+G V+G YS DG + R+VEY Sbjct: 42 AQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEY 87 >BT016021-1|AAV36906.1| 662|Drosophila melanogaster RE15373p protein. Length = 662 Score = 35.9 bits (79), Expect = 0.033 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 3/75 (4%) Frame = +3 Query: 198 APLIQHA---GPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVED 368 AP++Q P++ APV SY +PVVQ +Q APV+ A + V+ S Sbjct: 443 APVVQETIQQAPVIQQAPVVQQSYSAPAPVVQ--ETIQQAPVIQQAPV---VQQSYSAPA 497 Query: 369 HAPAKYEFSYSVEDP 413 AP + SYS P Sbjct: 498 PAPVVQQ-SYSAPAP 511 Score = 34.3 bits (75), Expect = 0.10 Identities = 22/69 (31%), Positives = 33/69 (47%) Frame = +3 Query: 126 EPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQH 305 + ++ A A APV+ A P++Q + APV SY +PVVQ +Q Sbjct: 396 QQTYSAPAPVVQETIQQAPVIQQA-PVVQQSYSAPAPAPVVQQSYSAPAPVVQ--ETIQQ 452 Query: 306 APVVHHAAI 332 APV+ A + Sbjct: 453 APVIQQAPV 461 Score = 31.9 bits (69), Expect = 0.54 Identities = 25/97 (25%), Positives = 38/97 (39%), Gaps = 1/97 (1%) Frame = +3 Query: 126 EPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQH 305 + S+ A A APV+ A P++Q + APV SY +P +Q Sbjct: 463 QQSYSAPAPVVQETIQQAPVIQQA-PVVQQSYSAPAPAPVVQQSYSAPAPAPVVQESIQQ 521 Query: 306 APVVHHA-AIPIAVEHSDHVEDHAPAKYEFSYSVEDP 413 APV+ + P V + V+ YS + P Sbjct: 522 APVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTP 558 Score = 28.7 bits (61), Expect = 5.1 Identities = 29/113 (25%), Positives = 44/113 (38%), Gaps = 2/113 (1%) Frame = +3 Query: 69 VIDEGHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVE 248 ++ + S Q+ + P Q+ PV+ +AP A +Q V A P Sbjct: 544 IVQQPQYSGYSYQTPQQAPAPIQQSLPAPAPVVI-SAPAPAPAPAPVQLQQSFVPAPPAP 602 Query: 249 HSSYIHASPVVQHFSPV--QHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS 401 A P+VQ+ PV Q A PI V + V APA+ +Y+ Sbjct: 603 IQIQQPAQPIVQYSPPVVQQQVTYTQPAPAPIQVAAAAPVAVSAPAEIGTNYA 655 >AE014298-2002|AAN09579.1| 662|Drosophila melanogaster CG11584-PB protein. Length = 662 Score = 35.9 bits (79), Expect = 0.033 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 3/75 (4%) Frame = +3 Query: 198 APLIQHA---GPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVED 368 AP++Q P++ APV SY +PVVQ +Q APV+ A + V+ S Sbjct: 443 APVVQETIQQAPVIQQAPVVQQSYSAPAPVVQ--ETIQQAPVIQQAPV---VQQSYSAPA 497 Query: 369 HAPAKYEFSYSVEDP 413 AP + SYS P Sbjct: 498 PAPVVQQ-SYSAPAP 511 Score = 34.3 bits (75), Expect = 0.10 Identities = 22/69 (31%), Positives = 33/69 (47%) Frame = +3 Query: 126 EPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQH 305 + ++ A A APV+ A P++Q + APV SY +PVVQ +Q Sbjct: 396 QQTYSAPAPVVQETIQQAPVIQQA-PVVQQSYSAPAPAPVVQQSYSAPAPVVQ--ETIQQ 452 Query: 306 APVVHHAAI 332 APV+ A + Sbjct: 453 APVIQQAPV 461 Score = 31.9 bits (69), Expect = 0.54 Identities = 25/97 (25%), Positives = 38/97 (39%), Gaps = 1/97 (1%) Frame = +3 Query: 126 EPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQH 305 + S+ A A APV+ A P++Q + APV SY +P +Q Sbjct: 463 QQSYSAPAPVVQETIQQAPVIQQA-PVVQQSYSAPAPAPVVQQSYSAPAPAPVVQESIQQ 521 Query: 306 APVVHHA-AIPIAVEHSDHVEDHAPAKYEFSYSVEDP 413 APV+ + P V + V+ YS + P Sbjct: 522 APVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTP 558 Score = 28.7 bits (61), Expect = 5.1 Identities = 29/113 (25%), Positives = 44/113 (38%), Gaps = 2/113 (1%) Frame = +3 Query: 69 VIDEGHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVE 248 ++ + S Q+ + P Q+ PV+ +AP A +Q V A P Sbjct: 544 IVQQPQYSGYSYQTPQQAPAPIQQSLPAPAPVVI-SAPAPAPAPAPVQLQQSFVPAPPAP 602 Query: 249 HSSYIHASPVVQHFSPV--QHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS 401 A P+VQ+ PV Q A PI V + V APA+ +Y+ Sbjct: 603 IQIQQPAQPIVQYSPPVVQQQVTYTQPAPAPIQVAAAAPVAVSAPAEIGTNYA 655 >AE014297-2840|AAF55794.1| 381|Drosophila melanogaster CG5494-PA protein. Length = 381 Score = 35.5 bits (78), Expect = 0.044 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 222 PIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVE-DHAPAKYEFSY 398 P VHAAPV +++ H + P+ H PV+ H +P+ H + HA A ++ Sbjct: 95 PQVHAAPVYAAAHAHGAYAPYAHGPI-HIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAH 153 Query: 399 SVEDPH 416 + H Sbjct: 154 NAGGHH 159 Score = 34.3 bits (75), Expect = 0.10 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +3 Query: 321 HAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGD-VVKGEYSLLQPDG 497 H A+ +H D P + +SY DP++ +HETR D G YS + G Sbjct: 20 HGAVSTQYQHLD------PHSHTYSYGYADPNS----QKHETRSHDGTTHGSYSYVDGHG 69 Query: 498 SIRKVEYT 521 ++ V YT Sbjct: 70 HVQSVSYT 77 Score = 34.3 bits (75), Expect = 0.10 Identities = 36/112 (32%), Positives = 48/112 (42%), Gaps = 13/112 (11%) Frame = +3 Query: 54 ICQGGV-IDEGHGHAVSSQSIVRHDEP-SHQATAHYTPV----LSHA--APVLTHAAPLI 209 + GGV +D A ++ H + H A AH PV + HA A HAA Sbjct: 180 LTHGGVPVDTPDVQAAKAEHYAAHAKALGHVAHAHGAPVETPEVQHAKAAHFAAHAAARS 239 Query: 210 QHAGPIVHAAPVEHSSYIHASPVVQHFSPV-----QHAPVVHHAAIPIAVEH 350 HA +P+ H Y H PV+ + PV QHA H+AA+ A H Sbjct: 240 GHA-----VSPINHGGY-HV-PVIHNGVPVDTPEVQHAKAAHYAALSQASAH 284 Score = 29.5 bits (63), Expect = 2.9 Identities = 34/123 (27%), Positives = 46/123 (37%), Gaps = 5/123 (4%) Frame = +3 Query: 87 GHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIH 266 GH + +SI QA AH P+ PV T + HA + H ++ H Sbjct: 157 GHHLYKRSIYGGGWAYGQA-AH-VPLTHGGVPVDTPDVQAAKAEHYAAHAKALGHVAHAH 214 Query: 267 ASPVVQHFSPVQHAPVVHHAAIPI-----AVEHSDHVEDHAPAKYEFSYSVEDPHTGDHK 431 +PV VQHA H AA AV +H H P + V+ P K Sbjct: 215 GAPV--ETPEVQHAKAAHFAAHAAARSGHAVSPINHGGYHVPVIHN-GVPVDTPEVQHAK 271 Query: 432 SQH 440 + H Sbjct: 272 AAH 274 >BT022990-1|AAY55406.1| 155|Drosophila melanogaster IP08464p protein. Length = 155 Score = 29.1 bits (62), Expect(2) = 0.077 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 108 SIVRHDEPSHQATAHYTPVLSHA-APVLTHAAPLIQHAGPIVHAAPV 245 ++VR + +++A AH PV++ A APV H P P V AP+ Sbjct: 32 AVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPL 78 Score = 24.6 bits (51), Expect(2) = 0.077 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 234 AAPVEHSSYIHAS-PVVQHFSPVQHAPVVHHAAIPI 338 A PV S++ HA+ P + H SP H P A P+ Sbjct: 113 ATPVLPSAHFHAAYPALAH-SPYAHYPAPGPAPAPV 147 >BT024389-1|ABC86451.1| 122|Drosophila melanogaster IP05464p protein. Length = 122 Score = 34.7 bits (76), Expect = 0.077 Identities = 22/79 (27%), Positives = 29/79 (36%) Frame = +3 Query: 192 HAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDH 371 H P + H H P H + H P+ H P H HH P H DH H Sbjct: 50 HPPPPVHH----YHPPPPVHHHHHHGPPMHHHGPPPHHH---HHYGPPPPPPHYDHHHHH 102 Query: 372 APAKYEFSYSVEDPHTGDH 428 + ++ + PH G H Sbjct: 103 HGSHFDHHHG---PHHGHH 118 >AE014296-2379|AAF49745.1| 102|Drosophila melanogaster CG13482-PA protein. Length = 102 Score = 34.7 bits (76), Expect = 0.077 Identities = 22/79 (27%), Positives = 29/79 (36%) Frame = +3 Query: 192 HAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDH 371 H P + H H P H + H P+ H P H HH P H DH H Sbjct: 30 HPPPPVHH----YHPPPPVHHHHHHGPPMHHHGPPPHHH---HHYGPPPPPPHYDHHHHH 82 Query: 372 APAKYEFSYSVEDPHTGDH 428 + ++ + PH G H Sbjct: 83 HGSHFDHHHG---PHHGHH 98 >BT011122-1|AAR82789.1| 201|Drosophila melanogaster LD11394p protein. Length = 201 Score = 34.3 bits (75), Expect = 0.10 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 3/93 (3%) Frame = +3 Query: 132 SHQATAHYTPVLS-HAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQ-- 302 SH + + PV S +AAP ++++AP +Q +AAP SY+ +P ++ PVQ Sbjct: 33 SHLSNEYLPPVQSSYAAPSVSYSAPAVQQ----TYAAPAIQQSYV--APSNEYLPPVQTY 86 Query: 303 HAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS 401 AP V AV+ + + + SYS Sbjct: 87 SAPAVQRTYSAPAVQRTYSAPSVSYSAPSVSYS 119 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/92 (23%), Positives = 44/92 (47%) Frame = +3 Query: 120 HDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPV 299 + P+ Q T + P +S++AP ++++AP + ++ P V + S A V Q +S Sbjct: 95 YSAPAVQRT-YSAPSVSYSAPSVSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSYS-- 151 Query: 300 QHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFS 395 AP V ++A + +S ++ +S Sbjct: 152 --APSVSYSAPAVQQSYSAPAVSYSAPSVSYS 181 >AE014298-2000|AAF48343.1| 186|Drosophila melanogaster CG1368-PA protein. Length = 186 Score = 34.3 bits (75), Expect = 0.10 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 3/93 (3%) Frame = +3 Query: 132 SHQATAHYTPVLS-HAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQ-- 302 SH + + PV S +AAP ++++AP +Q +AAP SY+ +P ++ PVQ Sbjct: 18 SHLSNEYLPPVQSSYAAPSVSYSAPAVQQ----TYAAPAIQQSYV--APSNEYLPPVQTY 71 Query: 303 HAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS 401 AP V AV+ + + + SYS Sbjct: 72 SAPAVQRTYSAPAVQRTYSAPSVSYSAPSVSYS 104 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/92 (23%), Positives = 44/92 (47%) Frame = +3 Query: 120 HDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPV 299 + P+ Q T + P +S++AP ++++AP + ++ P V + S A V Q +S Sbjct: 80 YSAPAVQRT-YSAPSVSYSAPSVSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSYS-- 136 Query: 300 QHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFS 395 AP V ++A + +S ++ +S Sbjct: 137 --APSVSYSAPAVQQSYSAPAVSYSAPSVSYS 166 >BT021350-1|AAX33498.2| 155|Drosophila melanogaster LP19160p protein. Length = 155 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +3 Query: 165 LSHAAPVLTHAAPLIQHA-GPIVHAAPVEHSSYIHASPVVQHFSPVQH-APVVHHAAIPI 338 +SH + H+ P+++ P+V V + + A+P+V+ +PV + AP+ + A + Sbjct: 56 VSHQSLTQVHSTPVVEDVVAPVVKTTAVHSAPVLAAAPIVKTLAPVAYSAPLAYSAPVAY 115 Query: 339 AVEHSDHVEDHAPAKYEFSYSVEDP 413 + ++ + AP Y S P Sbjct: 116 S-SYAAPLTYSAPVAYSAPLSYAAP 139 >AE014296-2688|AAF49499.1| 155|Drosophila melanogaster CG13044-PA protein. Length = 155 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +3 Query: 165 LSHAAPVLTHAAPLIQHA-GPIVHAAPVEHSSYIHASPVVQHFSPVQH-APVVHHAAIPI 338 +SH + H+ P+++ P+V V + + A+P+V+ +PV + AP+ + A + Sbjct: 56 VSHQSLTQVHSTPVVEDVVAPVVKTTAVHSAPVLAAAPIVKTLAPVAYSAPLAYSAPVAY 115 Query: 339 AVEHSDHVEDHAPAKYEFSYSVEDP 413 + ++ + AP Y S P Sbjct: 116 S-SYAAPLTYSAPVAYSAPLSYAAP 139 >AY071099-1|AAL48721.1| 153|Drosophila melanogaster RE16005p protein. Length = 153 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 225 IVHAAPVE-HSSYIHASPVVQHFSPVQHAPVVHHA 326 + H P+ H + +H++PVV H HA VVHH+ Sbjct: 84 VYHHEPLHYHYARLHSAPVVHHHHHDTHAAVVHHS 118 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 150 HYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIH 266 H+ P+ H A + H+AP++ H HAA V HS+ H Sbjct: 86 HHEPLHYHYARL--HSAPVVHHHHHDTHAAVVHHSTPAH 122 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 4/94 (4%) Frame = +3 Query: 90 HAVSSQSIVRHDEP-SHQATAHYTPVLSHAAPVLT-HAAPLIQHAGPIVHAAPVEHSSY- 260 H S ++V D +H H L + P H PL H + H+APV H + Sbjct: 50 HLGHSAALVHDDHHLNHHLDHHLDHHLVESLPTTVYHHEPLHYHYARL-HSAPVVHHHHH 108 Query: 261 -IHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 HA+ VV H +P H V H+ + +H+ H Sbjct: 109 DTHAA-VVHHSTPA-HFDVHSHSNLLSFAKHALH 140 >AE014296-1868|AAF50120.2| 153|Drosophila melanogaster CG14147-PA protein. Length = 153 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 225 IVHAAPVE-HSSYIHASPVVQHFSPVQHAPVVHHA 326 + H P+ H + +H++PVV H HA VVHH+ Sbjct: 84 VYHHEPLHYHYARLHSAPVVHHHHHDTHAAVVHHS 118 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 150 HYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIH 266 H+ P+ H A + H+AP++ H HAA V HS+ H Sbjct: 86 HHEPLHYHYARL--HSAPVVHHHHHDTHAAVVHHSTPAH 122 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 4/94 (4%) Frame = +3 Query: 90 HAVSSQSIVRHDEP-SHQATAHYTPVLSHAAPVLT-HAAPLIQHAGPIVHAAPVEHSSY- 260 H S ++V D +H H L + P H PL H + H+APV H + Sbjct: 50 HLGHSAALVHDDHHLNHHLDHHLDHHLVESLPTTVYHHEPLHYHYARL-HSAPVVHHHHH 108 Query: 261 -IHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 HA+ VV H +P H V H+ + +H+ H Sbjct: 109 DTHAA-VVHHSTPA-HFDVHSHSNLLSFAKHALH 140 >AY070660-1|AAL48131.1| 200|Drosophila melanogaster RH04437p protein. Length = 200 Score = 32.7 bits (71), Expect = 0.31 Identities = 30/94 (31%), Positives = 40/94 (42%), Gaps = 7/94 (7%) Frame = +3 Query: 90 HAVSSQSIVRHDEPSHQATAHYTPVLSHA--APVLTHAAPLIQHAGPIVHAAPVEHSSYI 263 H + + H +H A TP + HA A HAA HA +P+ H Y Sbjct: 18 HYAAHAKALGHVAHAHGAPVE-TPEVQHAKAAHFAAHAAARSGHA-----VSPINHGGY- 70 Query: 264 HASPVVQHFSPV-----QHAPVVHHAAIPIAVEH 350 H PV+ + PV QHA H+AA+ A H Sbjct: 71 HV-PVIHNGVPVDTPEVQHAKAAHYAALSQASAH 103 >AE013599-670|AAF59073.2| 112|Drosophila melanogaster CG14752-PA protein. Length = 112 Score = 32.7 bits (71), Expect = 0.31 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +3 Query: 228 VHAAPVEHSSYIHASPVVQHFS-PV-QHAPV--VHHAAIPIAVEHSDHVE 365 VH H +H PVV+H P+ + PV VHH IP+ V H H E Sbjct: 39 VHTVHHHHVQKVHV-PVVKHVPVPIYKEVPVHHVHHEEIPVPVHHVHHEE 87 >BT011532-1|AAS15668.1| 131|Drosophila melanogaster RE06402p protein. Length = 131 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +3 Query: 165 LSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAV 344 L++ AP L ++APL A V AAP + + + ++++ + APV+ A P+ Sbjct: 26 LAYTAP-LAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIAAAPVIAPVAAPVVA 84 Query: 345 EHS 353 +++ Sbjct: 85 KYA 87 >AY071430-1|AAL49052.1| 141|Drosophila melanogaster RE51966p protein. Length = 141 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +3 Query: 165 LSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAV 344 L++ AP L ++APL A V AAP + + + ++++ + APV+ A P+ Sbjct: 26 LAYTAP-LAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIAAAPVIAPVAAPVVA 84 Query: 345 EHS 353 +++ Sbjct: 85 KYA 87 >AE014296-3153|AAF49158.2| 141|Drosophila melanogaster CG18294-PA protein. Length = 141 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +3 Query: 165 LSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAV 344 L++ AP L ++APL A V AAP + + + ++++ + APV+ A P+ Sbjct: 26 LAYTAP-LAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIAAAPVIAPVAAPVVA 84 Query: 345 EHS 353 +++ Sbjct: 85 KYA 87 >AE014296-3152|AAF49159.2| 131|Drosophila melanogaster CG12519-PA protein. Length = 131 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +3 Query: 165 LSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAV 344 L++ AP L ++APL A V AAP + + + ++++ + APV+ A P+ Sbjct: 26 LAYTAP-LAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIAAAPVIAPVAAPVVA 84 Query: 345 EHS 353 +++ Sbjct: 85 KYA 87 >AE014296-3148|AAF49161.1| 162|Drosophila melanogaster CG14095-PA protein. Length = 162 Score = 32.3 bits (70), Expect = 0.41 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 2/89 (2%) Frame = +3 Query: 153 YTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAI 332 +TP+ + APV+ AP++ A V A + I A+PV+ PV APV+ A Sbjct: 23 HTPLAALPAPVIAAPAPVVTAASSQVVARTF---NGIAAAPVIAQV-PVAPAPVLRTVAA 78 Query: 333 PIAVEHSDHVED--HAPAKYEFSYSVEDP 413 P+A + + APA F+ V P Sbjct: 79 PLAAPLAAPLAAPLRAPAPVAFAAPVAAP 107 >AE014296-3149|AAF49160.1| 122|Drosophila melanogaster CG14096-PA protein. Length = 122 Score = 31.9 bits (69), Expect = 0.54 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +3 Query: 165 LSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAV 344 L++ AP L ++APL A V AAP + + + ++++ + APV+ A P+ Sbjct: 26 LAYTAP-LAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIAVAPVIAPVAAPVVA 84 Query: 345 EHS 353 +++ Sbjct: 85 KYT 87 >BT029065-1|ABJ16998.1| 175|Drosophila melanogaster IP07570p protein. Length = 175 Score = 31.5 bits (68), Expect = 0.72 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +3 Query: 330 IPIAVEHSDHVEDHA-PAKYEFSYSVEDPHTGDHKSQHETRDGDVVK-GEYSLLQPDGSI 503 IPI + + +D + +YE S+ TG K +G +V+ G+YS P+G++ Sbjct: 36 IPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTL 95 Query: 504 RKVEYT 521 V+YT Sbjct: 96 VNVQYT 101 >AE013599-1482|AAF58515.1| 190|Drosophila melanogaster CG8515-PA protein. Length = 190 Score = 31.5 bits (68), Expect = 0.72 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +3 Query: 330 IPIAVEHSDHVEDHA-PAKYEFSYSVEDPHTGDHKSQHETRDGDVVK-GEYSLLQPDGSI 503 IPI + + +D + +YE S+ TG K +G +V+ G+YS P+G++ Sbjct: 51 IPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTL 110 Query: 504 RKVEYT 521 V+YT Sbjct: 111 VNVQYT 116 >AE014296-2697|AAF49491.2| 155|Drosophila melanogaster CG13059-PA protein. Length = 155 Score = 31.1 bits (67), Expect = 0.95 Identities = 28/101 (27%), Positives = 51/101 (50%) Frame = +3 Query: 39 CSILAICQGGVIDEGHGHAVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHA 218 C +A G+I E H ++ +I+ + ++ T+ + + + L P++ ++ Sbjct: 10 CLAVAAAAPGLIAETH--SIVQPAILA--KTAYVDTSASSAITHQSNVNLVRKVPVV-YS 64 Query: 219 GPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIA 341 P+VHAAPV +HA+P+V+ P AP+V IP A Sbjct: 65 APVVHAAPV-----VHAAPLVKTVIPA--APLV-KTVIPAA 97 Score = 29.1 bits (62), Expect = 3.8 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 15/111 (13%) Frame = +3 Query: 72 IDEGHGHAVSSQS---IVRHDEPSHQA-TAHYTPVLSHAAPVL---THAAPLIQHAGP-- 224 +D A++ QS +VR + A H PV+ HAAP++ AAPL++ P Sbjct: 39 VDTSASSAITHQSNVNLVRKVPVVYSAPVVHAAPVV-HAAPLVKTVIPAAPLVKTVIPAA 97 Query: 225 -----IVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIA-VEHSDH 359 +V +AP+ H + + A+P+V+ P APV+ IP A + H+ H Sbjct: 98 PVLKTVVSSAPLVH-TVVPAAPLVKTVIPA--APVI-KTVIPAAPLVHTVH 144 >AE014296-861|AAF47911.2| 456|Drosophila melanogaster CG11350-PB protein. Length = 456 Score = 31.1 bits (67), Expect = 0.95 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +3 Query: 132 SHQATAHYTPVLSHAAPVLTHAAPLIQHAGPI-VHAAPVEHSSYIHASPVVQHFSPVQ-- 302 S+ A + ++ +AP +++AAP + +A P ++AP + ++P V + +P Q Sbjct: 57 SYSAPVESSYSVAASAPAVSYAAPAVSYAAPAQSYSAPAATYTAAASAPAVSYAAPAQSY 116 Query: 303 HAPVVHHAA 329 AP + A Sbjct: 117 SAPAATYTA 125 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 7/73 (9%) Frame = +3 Query: 132 SHQATAHYTPVLSHAAPVLTHAAPLIQHAGP-IVHAAPVEHSSYIHASPVVQHFSP---- 296 S + A P +S+AAP +++AAP ++ P + A + +A+P + +P Sbjct: 64 SSYSVAASAPAVSYAAPAVSYAAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATY 123 Query: 297 --VQHAPVVHHAA 329 AP V +AA Sbjct: 124 TAAASAPAVSYAA 136 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 129 PSHQATAHYTPVLSHAAPVLTHAAPLIQHAGP 224 P +Q+ A P +S+AAP T++AP + +A P Sbjct: 248 PVYQSAAS-APAVSYAAPAQTYSAPAVSYAEP 278 >AE013599-1477|AAF58517.1| 126|Drosophila melanogaster CG8510-PA protein. Length = 126 Score = 31.1 bits (67), Expect = 0.95 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +3 Query: 381 KYEFSYSVED----PHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 KY + Y ++D G KS + +G+ V G+YS + DG V YT Sbjct: 34 KYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYT 84 >AY094890-1|AAM11243.1| 517|Drosophila melanogaster RE59303p protein. Length = 517 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/78 (21%), Positives = 31/78 (39%) Frame = +3 Query: 207 IQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKY 386 I H +HA S+ H ++ H ++P HH + EHS ++ + ++ Sbjct: 222 IHHGEHDMHAITDLQGSH-HTEHILNHHDHSSNSPAHHHNSTAHHREHSSNITNEETSRN 280 Query: 387 EFSYSVEDPHTGDHKSQH 440 EDP K+ + Sbjct: 281 HIRNEDEDPDQNSSKTHY 298 >AY060872-1|AAL28420.1| 390|Drosophila melanogaster GM03781p protein. Length = 390 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/78 (21%), Positives = 31/78 (39%) Frame = +3 Query: 207 IQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKY 386 I H +HA S+ H ++ H ++P HH + EHS ++ + ++ Sbjct: 95 IHHGEHDMHAITDLQGSH-HTEHILNHHDHSSNSPAHHHNSTAHHREHSSNITNEETSRN 153 Query: 387 EFSYSVEDPHTGDHKSQH 440 EDP K+ + Sbjct: 154 HIRNEDEDPDQNSSKTHY 171 >AF145662-1|AAD38637.1| 675|Drosophila melanogaster BcDNA.GH10711 protein. Length = 675 Score = 30.7 bits (66), Expect = 1.3 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 10/148 (6%) Frame = +3 Query: 90 HAVSSQSIVRHDEPSH-QATAHYTPVLSHAAPVLTHAAPLI-QHAGPIVHAAPV--EHSS 257 + +S I +P+ QA A A+ V APLI Q P+ + + + S Sbjct: 439 YGMSRTGIYMPQQPAQLQAPAGQQQQQVQASVVWPQQAPLIPQQQSPVQQSQSLMPQQSG 498 Query: 258 YIHAS--PVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHK 431 +++A+ P +Q Q A + A P+A ++ D Y+ E P HK Sbjct: 499 HVYAAAAPAIQSPPAAQQAMLPVLNAAPVAGKNQGPAADGDYDDYDEETYTEAPKKKQHK 558 Query: 432 SQ----HETRDGDVVKGEYSLLQPDGSI 503 + +D + E + LQP+GS+ Sbjct: 559 HKKVKTKTAKDPIELALEQNKLQPEGSL 586 >AE014134-1949|AAF53007.1| 675|Drosophila melanogaster CG6495-PA protein. Length = 675 Score = 30.7 bits (66), Expect = 1.3 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 10/148 (6%) Frame = +3 Query: 90 HAVSSQSIVRHDEPSH-QATAHYTPVLSHAAPVLTHAAPLI-QHAGPIVHAAPV--EHSS 257 + +S I +P+ QA A A+ V APLI Q P+ + + + S Sbjct: 439 YGMSRTGIYMPQQPAQLQAPAGQQQQQVQASVVWPQQAPLIPQQQSPVQQSQSLMPQQSG 498 Query: 258 YIHAS--PVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHK 431 +++A+ P +Q Q A + A P+A ++ D Y+ E P HK Sbjct: 499 HVYAAAAPAIQSPPAAQQAMLPVLNAAPVAGKNQGPAADGDYDDYDEETYTEAPKKKQHK 558 Query: 432 SQ----HETRDGDVVKGEYSLLQPDGSI 503 + +D + E + LQP+GS+ Sbjct: 559 HKKVKTKTAKDPIELALEQNKLQPEGSL 586 >AE014134-1581|AAF52726.1| 517|Drosophila melanogaster CG31886-PA protein. Length = 517 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/78 (21%), Positives = 31/78 (39%) Frame = +3 Query: 207 IQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKY 386 I H +HA S+ H ++ H ++P HH + EHS ++ + ++ Sbjct: 222 IHHGEHDMHAITDLQGSH-HTEHILNHHDHSSNSPAHHHNSTAHHREHSSNITNEETSRN 280 Query: 387 EFSYSVEDPHTGDHKSQH 440 EDP K+ + Sbjct: 281 HIRNEDEDPDQNSSKTHY 298 >BT030206-1|ABN49345.1| 77|Drosophila melanogaster IP18040p protein. Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 222 PIVHAAPVEHS-SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ PV S + PVV++ VQH PV+ A+P H H Sbjct: 30 PVAQVVPVVKSVPVVQHVPVVKNVPVVQHVPVLKSYAVPTYGHHIYH 76 >BT029711-1|ABL75768.1| 77|Drosophila melanogaster IP17517p protein. Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 222 PIVHAAPVEHS-SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ PV S + PVV++ VQH PV+ A+P H H Sbjct: 30 PVAQVVPVVKSVPVVQHVPVVKNVPVVQHVPVLKSYAVPTYGHHIYH 76 >BT029646-1|ABL75705.1| 77|Drosophila melanogaster IP17217p protein. Length = 77 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 222 PIVHAAPVEHS-SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ PV S + PVV++ VQH PV+ A+P H H Sbjct: 30 PVAQVVPVVKSVPVVQHVPVVKNVPVVQHVPVLKSYAVPTYGHHIYH 76 >AY058378-1|AAL13607.1| 650|Drosophila melanogaster GH14380p protein. Length = 650 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 4/102 (3%) Frame = -3 Query: 405 RRNMRTHTSREHDLRHDRSVRRQLESQR----GARLEHVAQG*SVGLLAKHVYTKNVPRG 238 RR R + R DR RR+ R AR++ V Q + + + + Sbjct: 163 RRESREDREDRRESRADREDRRESREDRLEGREARVQRVEQREARDNQVELREIREIREH 222 Query: 237 RREQ*DRHVESKGLRESVLEQHDSILGYNVPLLDEKARHGER 112 RR + VE +G+RE +E+H++ G E R GER Sbjct: 223 RRVTPEERVEQRGIREDRVERHEADEGQRDTRKME--RRGER 262 >AE014298-800|AAF46086.2| 650|Drosophila melanogaster CG12239-PA protein. Length = 650 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 4/102 (3%) Frame = -3 Query: 405 RRNMRTHTSREHDLRHDRSVRRQLESQR----GARLEHVAQG*SVGLLAKHVYTKNVPRG 238 RR R + R DR RR+ R AR++ V Q + + + + Sbjct: 163 RRESREDREDRRESRADREDRRESREDRLEGREARVQRVEQREARDNQVELREIREIREH 222 Query: 237 RREQ*DRHVESKGLRESVLEQHDSILGYNVPLLDEKARHGER 112 RR + VE +G+RE +E+H++ G E R GER Sbjct: 223 RRVTPEERVEQRGIREDRVERHEADEGQRDTRKME--RRGER 262 >AE013599-1761|AAF58340.2| 1093|Drosophila melanogaster CG6280-PA protein. Length = 1093 Score = 30.3 bits (65), Expect = 1.7 Identities = 23/93 (24%), Positives = 35/93 (37%) Frame = +3 Query: 93 AVSSQSIVRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHAS 272 AVS S+ S ++ H PV T QH P +H +H IH Sbjct: 689 AVSHASVHLDTNHSGLTAPGHSEQTVHPGPVYTQPE---QHPEPQIHQIHQDHH-IIHHE 744 Query: 273 PVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDH 371 P +H + + HH + H + ++DH Sbjct: 745 PQPEHEPHLHQDHLEHHEHPSLQPYHVEKLKDH 777 >AF245116-1|AAF66981.1| 743|Drosophila melanogaster cactin protein. Length = 743 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = -3 Query: 465 SRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLE 307 S+H H D R DPR + RE + DR R + +R R E Sbjct: 6 SKHRHRSRSRERRDHRSPDPRSSRNRDRDREREREKDRDHRDHRDKERDQRRE 58 >AE014298-3022|AAF50904.2| 762|Drosophila melanogaster CG1676-PA protein. Length = 762 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = -3 Query: 465 SRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLE 307 S+H H D R DPR + RE + DR R + +R R E Sbjct: 48 SKHRHRSRSRERRDHRSPDPRSSRNRDRDREREREKDRDHRDHRDKERDQRRE 100 >AY070982-1|AAL48604.1| 306|Drosophila melanogaster RE07882p protein. Length = 306 Score = 29.5 bits (63), Expect = 2.9 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 6/71 (8%) Frame = +3 Query: 186 LTHAAPLIQHAGP--IVHAAP--VEHSSYIHASPVVQHFSP--VQHAPVVHHAAIPIAVE 347 + H + H P I H P +EH H +V H ++H + HH +P VE Sbjct: 214 VVHYPHHVDHVVPHHIEHVVPHHIEHVVPHHIEHIVPHHIDHHLEHH-IDHHVDLP--VE 270 Query: 348 HSDHVEDHAPA 380 H +H+E +PA Sbjct: 271 HIEHLEHPSPA 281 >AE014297-436|AAF51889.2| 306|Drosophila melanogaster CG1169-PA protein. Length = 306 Score = 29.5 bits (63), Expect = 2.9 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 6/71 (8%) Frame = +3 Query: 186 LTHAAPLIQHAGP--IVHAAP--VEHSSYIHASPVVQHFSP--VQHAPVVHHAAIPIAVE 347 + H + H P I H P +EH H +V H ++H + HH +P VE Sbjct: 214 VVHYPHHVDHVVPHHIEHVVPHHIEHVVPHHIEHIVPHHIDHHLEHH-IDHHVDLP--VE 270 Query: 348 HSDHVEDHAPA 380 H +H+E +PA Sbjct: 271 HIEHLEHPSPA 281 >AE013599-3953|AAF47269.1| 92|Drosophila melanogaster CG16914-PA protein. Length = 92 Score = 29.5 bits (63), Expect = 2.9 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +3 Query: 384 YEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYT 521 YE S + TG K +H D VV GEY + P+G KV YT Sbjct: 38 YELSNHIRAVQTGALK-EH---DNWVVSGEYEYVAPNGKTVKVVYT 79 >BT023552-1|AAY84952.1| 317|Drosophila melanogaster IP09780p protein. Length = 317 Score = 29.1 bits (62), Expect = 3.8 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = +3 Query: 129 PSHQATAHYTPVL--SHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIH-ASPVVQHFSPV 299 P++ A A PV + AAPV+ AP P+ APV +H A+P++ H +PV Sbjct: 199 PANVAPAPAAPVAPAAPAAPVVP-VAPAAPSVVPVAPVAPV----VVHPAAPILVHPAPV 253 Query: 300 QHAPVVHHAAIPIA 341 PV A PIA Sbjct: 254 ---PVAAPAPAPIA 264 >BT003229-1|AAO24984.1| 324|Drosophila melanogaster LP08773p protein. Length = 324 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 KY+ SY E+ G+ +++ G KG Y DG + +V Y Sbjct: 174 KYDHSYLTENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNY 219 >AY094787-1|AAM11140.1| 977|Drosophila melanogaster LD14856p protein. Length = 977 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/109 (18%), Positives = 41/109 (37%) Frame = +3 Query: 180 PVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ P + P+ + + + S ++ S H+P H+ + + +D Sbjct: 851 PIARGMRPRRSYKAPLSQKIAIHKRNVVIVSDEEENTSEYSHSPSSQHSTLESNTDIADM 910 Query: 360 VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIR 506 + A + SYS + + D + + K E L P G++R Sbjct: 911 KKTQATSTSSNSYSEPEDDSSDSSDEEQGNRPTEAKAEGPAL-PMGAVR 958 >AY052054-1|AAK93478.1| 294|Drosophila melanogaster LP07813p protein. Length = 294 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 KY+ SY E+ G+ +++ G KG Y DG + +V Y Sbjct: 144 KYDHSYLTENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNY 189 >AE014297-600|AAF54028.2| 269|Drosophila melanogaster CG31496-PA protein. Length = 269 Score = 29.1 bits (62), Expect = 3.8 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = +3 Query: 129 PSHQATAHYTPVL--SHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIH-ASPVVQHFSPV 299 P++ A A PV + AAPV+ AP P+ APV +H A+P++ H +PV Sbjct: 151 PANVAPAPAAPVAPAAPAAPVVP-VAPAAPSVVPVAPVAPV----VVHPAAPILVHPAPV 205 Query: 300 QHAPVVHHAAIPIA 341 PV A PIA Sbjct: 206 ---PVAAPAPAPIA 216 >AE014296-3191|AAO41222.1| 977|Drosophila melanogaster CG8789-PC, isoform C protein. Length = 977 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/109 (18%), Positives = 41/109 (37%) Frame = +3 Query: 180 PVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ P + P+ + + + S ++ S H+P H+ + + +D Sbjct: 851 PIARGMRPRRSYKAPLSQKIAIHKRNVVIVSDEEENTSEYSHSPSSQHSTLESNTDIADM 910 Query: 360 VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIR 506 + A + SYS + + D + + K E L P G++R Sbjct: 911 KKTQATSTSSNSYSEPEDDSSDSSDEEQGNRPTEAKAEGPAL-PMGAVR 958 >AE014296-3190|AAO41221.1| 977|Drosophila melanogaster CG8789-PB, isoform B protein. Length = 977 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/109 (18%), Positives = 41/109 (37%) Frame = +3 Query: 180 PVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ P + P+ + + + S ++ S H+P H+ + + +D Sbjct: 851 PIARGMRPRRSYKAPLSQKIAIHKRNVVIVSDEEENTSEYSHSPSSQHSTLESNTDIADM 910 Query: 360 VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIR 506 + A + SYS + + D + + K E L P G++R Sbjct: 911 KKTQATSTSSNSYSEPEDDSSDSSDEEQGNRPTEAKAEGPAL-PMGAVR 958 >AE014296-3189|AAF49129.3| 977|Drosophila melanogaster CG8789-PA, isoform A protein. Length = 977 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/109 (18%), Positives = 41/109 (37%) Frame = +3 Query: 180 PVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ P + P+ + + + S ++ S H+P H+ + + +D Sbjct: 851 PIARGMRPRRSYKAPLSQKIAIHKRNVVIVSDEEENTSEYSHSPSSQHSTLESNTDIADM 910 Query: 360 VEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIR 506 + A + SYS + + D + + K E L P G++R Sbjct: 911 KKTQATSTSSNSYSEPEDDSSDSSDEEQGNRPTEAKAEGPAL-PMGAVR 958 >AE014296-3154|AAN11648.1| 154|Drosophila melanogaster CG32213-PA protein. Length = 154 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 186 LTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIPIA 341 L + APL A V AAP + + + ++++ + APV+ A P+A Sbjct: 51 LAYTAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIASAPVIAPVAAPLA 102 >AE013599-1471|AAG22279.3| 294|Drosophila melanogaster CG8502-PA, isoform A protein. Length = 294 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 KY+ SY E+ G+ +++ G KG Y DG + +V Y Sbjct: 144 KYDHSYLTENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNY 189 >AE013599-1470|AAF58521.3| 324|Drosophila melanogaster CG8502-PC, isoform C protein. Length = 324 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 381 KYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEY 518 KY+ SY E+ G+ +++ G KG Y DG + +V Y Sbjct: 174 KYDHSYLTENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNY 219 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDRDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QXAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QXAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/68 (26%), Positives = 26/68 (38%) Frame = +3 Query: 255 SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYSVEDPHTGDHKS 434 S+ ++ ++F P Q AP H H DH DH + + + H DH Sbjct: 43 SFKYSREANENFDP-QKAPRAEHP------HHHDHDHDHGHHHHGHDHDHDHDHGHDHGH 95 Query: 435 QHETRDGD 458 H D D Sbjct: 96 HHHGHDHD 103 >BT029692-1|ABL75749.1| 77|Drosophila melanogaster IP17417p protein. Length = 77 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +3 Query: 222 PIVHAAPVEHS-SYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDH 359 P+ PV S + PVV++ QH PV+ A+P H H Sbjct: 30 PVAQVVPVVKSVPVVQHVPVVKNVPVAQHVPVLKSYAVPTYGHHIYH 76 >BT023016-1|AAY55432.1| 176|Drosophila melanogaster IP04080p protein. Length = 176 Score = 28.7 bits (61), Expect = 5.1 Identities = 21/61 (34%), Positives = 31/61 (50%) Frame = +3 Query: 153 YTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAI 332 +TP+ + APV+ AP++ A V A + I A+PV+ PV APV+ A Sbjct: 33 HTPLAALPAPVIAAPAPVVTAASSQVVARTF---NGIAAAPVIAQV-PVAPAPVLRTVAS 88 Query: 333 P 335 P Sbjct: 89 P 89 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 28.7 bits (61), Expect = 5.1 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = +3 Query: 291 SPVQHAPVVHHAAIPIAVEHSDHVEDHAPAKYEFSYS----VEDPHTGDHKSQHETRDGD 458 SP AP IPI S E+ Y FSY ++ G K++ + Sbjct: 47 SPSGGAPPTSGPPIPIL---SFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIP 103 Query: 459 VVKGEYSLLQPDGSIRKVEYT 521 V G YS P+G + ++ YT Sbjct: 104 SVMGSYSYTNPEGELVEIMYT 124 >BT004856-1|AAO45212.1| 372|Drosophila melanogaster RE59371p protein. Length = 372 Score = 28.7 bits (61), Expect = 5.1 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 318 HHAAIPIAVEHSDHVEDH-APAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPD 494 HH IP +++H DH E + AP+ ++ S E P++G + S + V G+Y P Sbjct: 121 HHDHIPYSLDH-DHSEHYDAPSSFDSGASFE-PYSG-YSSYAGSDIVSDVHGDYHSESPS 177 Query: 495 G 497 G Sbjct: 178 G 178 >AY118689-1|AAM50549.1| 893|Drosophila melanogaster AT15637p protein. Length = 893 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/69 (26%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +3 Query: 249 HSSYIHASPVVQHFSPVQHAPVVHHAAIPIAVEHSDHVE----DHAPAKYEFSYSVEDPH 416 H S + QHFS H P +HH + + H + H PA + + P Sbjct: 482 HPSQLQQQQPQQHFSSPHHMPPMHHQHQLMMQQQHRHNQRSPLHHHPAAQQLQQQHQQP- 540 Query: 417 TGDHKSQHE 443 H QH+ Sbjct: 541 --SHSPQHQ 547 >AY071497-1|AAL49119.1| 1324|Drosophila melanogaster RE55745p protein. Length = 1324 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +2 Query: 128 AFSSSNGTLYPSIESCCSSTDSRSPFDSTCRSYCSRRPRGTFFVYTCFASSPTLQPC 298 AF S+ G ++E CS+ + + D T +Y G F+V C ++ T+QPC Sbjct: 632 AFDSATGQCSTTVE--CSAKNCATASDGT--TYPVAGETGQFYV--CLSNEATIQPC 682 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,262,347 Number of Sequences: 53049 Number of extensions: 719464 Number of successful extensions: 3916 Number of sequences better than 10.0: 383 Number of HSP's better than 10.0 without gapping: 3160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3788 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -