BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H10f (504 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0113 + 9280756-9283489,9283726-9284048,9284201-9284314 27 6.5 07_03_0182 - 14815467-14815488,14815604-14815943,14816860-148172... 27 6.5 10_06_0102 + 10758601-10758948,10759051-10759257,10759349-107595... 27 8.6 02_01_0767 - 5709733-5709789,5709845-5709871,5710374-5710449,571... 27 8.6 >10_05_0113 + 9280756-9283489,9283726-9284048,9284201-9284314 Length = 1056 Score = 27.5 bits (58), Expect = 6.5 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 70 IYIN*ETNNSIGILIYGYIELQFDMHIIKLHRSLLK--IKNAIPRYSTITAL 219 IYIN + NN GIL L ++ I+L + + + I RY+ +T+L Sbjct: 359 IYINLQLNNLSGILPNTIANLSLELQSIRLGGNQISGILPKGIGRYAKLTSL 410 >07_03_0182 - 14815467-14815488,14815604-14815943,14816860-14817220, 14817232-14817666,14818042-14818149 Length = 421 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 264 GYDSGRKIIAS-KTKFSKQNTRTKHDRRETNSLKYASL 374 G D G+ I+ S K ++ + + H R TN LKY L Sbjct: 279 GTDKGKNILFSLKKRYLLAHLQAGHSRMATNILKYVDL 316 >10_06_0102 + 10758601-10758948,10759051-10759257,10759349-10759507, 10759617-10759709,10759913-10760008,10760457-10760724, 10760805-10761047,10761298-10761422,10761499-10761615, 10761705-10761779,10761886-10761942,10762035-10762139, 10762244-10762330,10762790-10763047,10763075-10763263, 10763418-10763528,10763640-10763729,10763814-10763990, 10764075-10764152,10764412-10764726,10764819-10765162, 10765304-10765541,10765631-10765998,10766106-10766316, 10766622-10766801,10766886-10769045,10769151-10769207 Length = 2251 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 231 IHRDTGVSPYTGYDSGRKIIASKTKFSKQNTRT 329 I R G+ GYD+ RKI A TKF N ++ Sbjct: 392 IRRFYGMEHGGGYDAWRKISAVATKFDLDNAQS 424 >02_01_0767 - 5709733-5709789,5709845-5709871,5710374-5710449, 5710542-5710661,5711321-5711421,5711618-5711743, 5713504-5713596,5713694-5713816,5713889-5714032, 5714539-5714672,5714893-5715002,5715315-5715430, 5716438-5716572,5716650-5716820,5717545-5717709, 5718165-5718242,5718313-5718445,5718551-5718741, 5718842-5718914,5719001-5719056,5719142-5719300, 5719383-5719496,5719562-5719654,5720544-5720726, 5720801-5720878,5720966-5721052,5721135-5721216, 5721288-5721400,5721486-5721636,5721759-5721877, 5721966-5722163,5722377-5722442,5723837-5723957, 5724224-5724343,5724412-5724542,5725210-5725341, 5725418-5725519,5726231-5726437,5726510-5726626, 5727468-5727623,5727721-5727810,5728624-5728848, 5728969-5729091,5729202-5729284,5729459-5729618, 5730264-5730374,5730652-5730751,5731375-5731454, 5731752-5731847,5731961-5732110 Length = 1991 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 67 DIYIN*ETNNSIGILIYGYIELQFDMHIIKLHRSLLKIKNAIPRYSTI 210 D IN T + GIL+ + L F++ I+ + R L+ P Y + Sbjct: 811 DTLINERTTQTYGILLEKTVHLSFEIFILVMERDLVLADVFRPLYQPL 858 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,196,915 Number of Sequences: 37544 Number of extensions: 171216 Number of successful extensions: 315 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -