BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H10f (504 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15680.1 68418.m01834 expressed protein 30 1.0 At5g53080.1 68418.m06594 kinesin light chain-related low similar... 27 7.2 >At5g15680.1 68418.m01834 expressed protein Length = 2151 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 343 EKQIALNMPRYYGWQCIMLNNDKVPYNAMPLVQYYTRS 456 E ++ +++ W C+ L D+V +A+PL Q Y ++ Sbjct: 1885 ETRLLMHITGLLPWLCLQLTQDQVMVSALPLQQQYQKA 1922 >At5g53080.1 68418.m06594 kinesin light chain-related low similarity to kinesin light chain from [Plectonema boryanum] GI:2645229, [Loligo pealei] GI:403179; contains Pfam profile PF00515: TPR Domain Length = 564 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 367 PRYYGWQCIMLNNDK 411 PRY WQC+ L N K Sbjct: 29 PRYSTWQCVCLRNQK 43 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,696,212 Number of Sequences: 28952 Number of extensions: 154067 Number of successful extensions: 329 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 329 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -