BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H08f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 27 0.29 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 8.2 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 8.2 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 8.2 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 8.2 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 27.5 bits (58), Expect = 0.29 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 447 SNMQKLLSTDLVSVTSIGNVRFLASFLIAAEDSVSTFMAF 328 SN QK+L D+V ++ + F +A D+++T M F Sbjct: 305 SNEQKILPEDMVKLSENEMIAQCLLFFLAGFDTIATSMTF 344 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 9 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 41 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 9 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 41 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 FRPWWFALLTSFRSYPSFLYVATIVYSFSTSVL 99 + P W L + P F++ + +SF T L Sbjct: 20 YGPGWVLLTDAVVRMPLFIFCSIFTFSFYTPAL 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,827 Number of Sequences: 2352 Number of extensions: 5534 Number of successful extensions: 48 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -