BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H06f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0146 + 10744403-10744603,10745199-10745834,10745967-107461... 27 6.9 07_03_1721 - 29023979-29025295 27 6.9 >11_03_0146 + 10744403-10744603,10745199-10745834,10745967-10746125, 10746398-10747036,10748018-10748151,10748281-10748464, 10748882-10749217,10751659-10751945,10752863-10753253, 10753351-10753615,10753740-10753818,10754123-10754543 Length = 1243 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -3 Query: 435 NIQ*TLGEMNPNDTENESPHRHSPLSFSP 349 ++Q T ++NPND+E++ +H + SP Sbjct: 403 DVQFTSADINPNDSEDQQQQQHHGCNGSP 431 >07_03_1721 - 29023979-29025295 Length = 438 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -2 Query: 508 PFECHWSPTWHTKVIMSISVTKAPEYPVDSGRDES 404 PF WSP W+ M+ V AP P +S + S Sbjct: 248 PFVYPWSPAWNGIPAMAPPVCTAPAEPANSSDNGS 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,209,255 Number of Sequences: 37544 Number of extensions: 246820 Number of successful extensions: 540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -