BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 25 1.2 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 24 2.7 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 3.6 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 25.4 bits (53), Expect = 1.2 Identities = 24/91 (26%), Positives = 34/91 (37%), Gaps = 3/91 (3%) Frame = +1 Query: 67 YGVKVVIKDMNGKDM--PFEVSFKASGIVDYNNV-LKHMATGGSSLNAPTDTIQCIDIVL 237 YG V + ++G D+ + SF YN + M P + +Q IDIV Sbjct: 421 YGSSVDMIKLSGADLWSAIDHSFTLDDEFRYNTAQVSGMTVVADLSKKPYERVQSIDIVG 480 Query: 238 KQGTLESYVKAGRQYFMRPASPIDLGDGLEM 330 G + K Y P+ D DG M Sbjct: 481 ANGAKTALKKDQIYYVAVPSYLADGKDGFAM 511 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 386 STLMKAFDVNIADWNKPVHISSP 318 +T+ D DW+KP HI P Sbjct: 220 ATIADPDDTKPEDWDKPEHIPDP 242 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 3.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -1 Query: 275 LPAFTYDSNVPCFNTMSIHCMVSVGALRDDPPV 177 L AFT + PC + +H ++ LR PV Sbjct: 797 LAAFTPNIGGPCSSIRRLHANCAISVLRYGAPV 829 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,363 Number of Sequences: 2352 Number of extensions: 14147 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -