BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1642 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 2/20 (10%) Frame = +3 Query: 231 NLFSVICILHMSY--KCVII 284 NLFS+ CILH+S+ KC+++ Sbjct: 616 NLFSIDCILHISFVRKCLVL 635 >SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1922 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 231 NLFSVICILHMSYKCVII*NGNIFVLNQFTIET 329 N++ +C + + Y+C+I + I + N F I+T Sbjct: 203 NIYVDVCDMFVKYECLIAISTEIQIANHFRIKT 235 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,200,283 Number of Sequences: 59808 Number of extensions: 227929 Number of successful extensions: 286 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -