BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H02f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 165 2e-43 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 27 0.088 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.1 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 1.4 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 5.8 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 165 bits (402), Expect = 2e-43 Identities = 77/82 (93%), Positives = 80/82 (97%) Frame = -1 Query: 521 TVYNFIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERK 342 T YN IMKCDVDIRKDLYANTV+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPE+K Sbjct: 52 TTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKK 111 Query: 341 YSVWIGGSILASLSTFQQMWIS 276 YSVWIGGSILASLSTFQQMWIS Sbjct: 112 YSVWIGGSILASLSTFQQMWIS 133 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 27.5 bits (58), Expect = 0.088 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -3 Query: 471 VRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREEVLRM 331 +++H H++ +HH + + HRP Q Q + R+E R+ Sbjct: 138 LQRHHHLQNHHH--HLQSTAVQDHHRPYQQQQQQQQRQQQRQEERRL 182 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 1.1 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +3 Query: 102 DGVRLDVQFSGITRYNVLTVAFRTRTSTTPHSTGVT--RPRCLEALAVDDAGAGLVVFL 272 D +LD F T+ N + ++ R++ STT G T + + AL +D FL Sbjct: 354 DSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPTPAQKARMRALNIDRVSRVFFPFL 412 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 1.1 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -1 Query: 488 DIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWI 327 DI++ Y + V MYP + M+K I+ + KI I P E K +WI Sbjct: 349 DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--IWI 398 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.4 bits (48), Expect = 1.4 Identities = 13/60 (21%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = -3 Query: 513 QLHHEVRRRHP*GPVRQHRH---VRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREE 343 Q+HH++ +HP +Q +H + H + + + +A Q Q PR++ Sbjct: 167 QMHHQMHTQHPHMQPQQGQHQSQAQQQHLQAHEQHMMYQQQQQSQAASQQSQPGMHPRQQ 226 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 513 QLHHEVRRRHP*GPVRQHR 457 QL+ +V+ H PV+QHR Sbjct: 266 QLNSDVQPGHGSPPVKQHR 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,024 Number of Sequences: 438 Number of extensions: 2603 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -