BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302H01f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.62 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 21 5.8 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.62 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 204 PSNSSTMFTRELHPLASKYKFPNTTSFSLVEITAT 100 P N + +R LHP AS P T + + T T Sbjct: 83 PGNLEQIGSRPLHPPASSTSLPATITTTTTTTTTT 117 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 371 GKVLDICEARKSDCASEDGSTVVNAKLK 454 G+VL +R C EDG + +L+ Sbjct: 169 GRVLACISSRPGQCGREDGYILEGKELE 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,277 Number of Sequences: 438 Number of extensions: 3419 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -