BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302G11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 86 6e-19 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 83 4e-18 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 83 5e-18 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 79 7e-17 AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 pr... 77 3e-16 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 64 2e-12 AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 62 1e-11 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 61 3e-11 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 57 4e-10 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 56 5e-10 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 56 5e-10 AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CY... 55 1e-09 AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 pr... 55 2e-09 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 55 2e-09 AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 pr... 54 2e-09 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 54 3e-09 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 54 3e-09 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 53 5e-09 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 53 7e-09 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 51 2e-08 AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CY... 50 4e-08 AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CY... 50 4e-08 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 50 4e-08 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 50 4e-08 AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 pr... 50 5e-08 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 50 5e-08 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 50 6e-08 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 49 1e-07 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 49 1e-07 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 48 1e-07 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 48 1e-07 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 48 1e-07 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 47 3e-07 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 47 3e-07 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 47 4e-07 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 47 4e-07 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 46 6e-07 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 46 8e-07 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 46 1e-06 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 46 1e-06 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 44 3e-06 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 44 4e-06 AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 pr... 43 5e-06 AY748837-1|AAV28185.1| 97|Anopheles gambiae cytochrome P450 pr... 43 5e-06 AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CY... 43 5e-06 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 43 5e-06 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 43 7e-06 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 42 2e-05 AY062195-1|AAL58556.1| 139|Anopheles gambiae cytochrome P450 CY... 40 5e-05 AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 pr... 38 2e-04 AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 38 3e-04 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 34 0.003 AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 pr... 33 0.008 AY745217-1|AAU93484.1| 98|Anopheles gambiae cytochrome P450 pr... 32 0.013 AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 31 0.018 AY748851-1|AAV28197.1| 98|Anopheles gambiae cytochrome P450 pr... 30 0.054 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 30 0.054 AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 pr... 29 0.072 AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 pr... 29 0.095 AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 pr... 29 0.13 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 27 0.29 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 27 0.38 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 27 0.50 AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 pr... 26 0.67 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 26 0.88 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 25 1.5 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 25 2.0 AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 pr... 24 2.7 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 8.2 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 8.2 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 86.2 bits (204), Expect = 6e-19 Identities = 52/167 (31%), Positives = 83/167 (49%), Gaps = 12/167 (7%) Frame = +3 Query: 57 IDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AMLCSEDLAGAPSVRA 221 +D + AGI+T ++ +LY L+ P+ Q K+ EL + L +E++ P +RA Sbjct: 320 LDMLIAGIDTTSSGSTGVLYCLAKNPEKQAKLREELRTILPKKDSPLTAENMHNLPYLRA 379 Query: 222 AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 I E R+ R + + G++IP GT + +A R E+ F RA EYLPER Sbjct: 380 CIKEGLRMYQPVAGNMRAAGRDLVLQGYQIPKGTDIAMGSAVLQRSEKYFRRASEYLPER 439 Query: 402 WIKVQEPHAYS-------LVAPFGRGRRMCPGKRFVELELHLLLAKI 521 W+ + S + PFG G R C G+R +EL ++ A++ Sbjct: 440 WLSERPADVPSVKDSNPFIFLPFGFGARSCIGRRLAMMELEMITARL 486 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 83.4 bits (197), Expect = 4e-18 Identities = 56/178 (31%), Positives = 93/178 (52%), Gaps = 17/178 (9%) Frame = +3 Query: 39 DKKAAII---DFITAGIETLANSLVFLLYLLSGRPDWQ----RKINSELPPY-AMLCSED 194 +K+ A++ D I AGI+T ++S +LY L+ P Q +++ S LP + + L E+ Sbjct: 310 NKQLAVVMAFDMIMAGIDTTSSSTFGILYCLAKNPSKQAILRKELRSILPHHDSPLTPEN 369 Query: 195 LAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFW 374 + P +RA I E RL P R + + + G++IP GT V+ T A R F Sbjct: 370 MRNLPYLRACIKEGLRLYQPTPANVRNVGHNIVLQGYRIPKGTEVVMGTLALQRDAAYFP 429 Query: 375 RAEEYLPERWI---------KVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 + + +LPERW+ +E H + + PFG G R C GKR +E+ +++A++ Sbjct: 430 QPDAFLPERWLPDGQGMGIPSGKEAHPF-IFLPFGFGARSCIGKRLAMMEMEIVIARL 486 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 83.0 bits (196), Expect = 5e-18 Identities = 51/166 (30%), Positives = 82/166 (49%), Gaps = 12/166 (7%) Frame = +3 Query: 57 IDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AMLCSEDLAGAPSVRA 221 +D I AGI+T + V +LY L+ P+ Q K+ +EL L + ++ P +RA Sbjct: 313 LDMIFAGIDTTSAGSVAILYCLAKNPEKQAKLRAELRTIMPTKDTRLTASMMSNLPYLRA 372 Query: 222 AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 I E R+ P A R + + G+++P T + R E+ F R E++PER Sbjct: 373 CIKEGMRMFPPAAGNFRATGRDIVLQGYRVPSDTDIAMGAQVLLRDEKYFHRPTEFIPER 432 Query: 402 WIKVQE---PHAYS----LVAPFGRGRRMCPGKRFVELELHLLLAK 518 W+ ++ P A + PFG G R C GKR +E+ ++LA+ Sbjct: 433 WLNDRDASIPSAKEVNPFIFLPFGFGSRSCIGKRLAMMEMEVILAR 478 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 79.4 bits (187), Expect = 7e-17 Identities = 50/178 (28%), Positives = 86/178 (48%), Gaps = 17/178 (9%) Frame = +3 Query: 39 DKKAAI---IDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AMLCSED 194 D+ AA +D + AG++T ++ +LY L+ P+ Q K+ +EL + L ++ Sbjct: 309 DRNAAFTMSMDSLFAGVDTTSSGSTGILYCLAKNPEKQEKLRAELRKIMPNKDSPLTPDN 368 Query: 195 LAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFW 374 + P +RA I E+ R+ P R + + G+++P G V R E F Sbjct: 369 MKNMPYLRACIKESLRMYPPTSGNGRCTGKDLVLQGYRVPKGILVGMGQLVLQREEGYFT 428 Query: 375 RAEEYLPERWI---------KVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 R E++PERW+ +E H + + PFG G R C GKR +E+ +L+ ++ Sbjct: 429 RPSEFMPERWLSGEAAAGCPSAKEVHPF-VYLPFGFGARSCIGKRLAMMEMEILVCRM 485 >AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 77.4 bits (182), Expect = 3e-16 Identities = 39/86 (45%), Positives = 55/86 (63%), Gaps = 11/86 (12%) Frame = +3 Query: 294 IGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERWI-----------KVQEPHAYSLV 440 + G+ + GT VL HT AC E+NF +A+ +LP+RW+ K EP A S+V Sbjct: 2 LSGYHLQAGTLVLCHTRVACLSEDNFQQADRFLPDRWLEQRDENDNVVNKRAEPGA-SVV 60 Query: 441 APFGRGRRMCPGKRFVELELHLLLAK 518 PFG GRRMCPG++ +++EL LL+AK Sbjct: 61 LPFGIGRRMCPGQKVIDIELTLLVAK 86 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 64.5 bits (150), Expect = 2e-12 Identities = 43/147 (29%), Positives = 70/147 (47%), Gaps = 8/147 (5%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSEL----PPY--AMLCSEDLAGAPSVRAA 224 F+ G +T + ++L+LL+ PD Q ++ E+ PP +DL + Sbjct: 5 FMFEGHDTTTAGISWVLFLLALHPDVQERVCEEIESIFPPGDDRPATMQDLNELKLLERC 64 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERW 404 I EA RL P+ F R L + +GGH++P T V H R E + E++ P+R+ Sbjct: 65 IKEALRLYPSVSFFGRTLSEDVQLGGHQVPAQTIVGIHAYHVHRDERFYPDPEKFDPDRF 124 Query: 405 I--KVQEPHAYSLVAPFGRGRRMCPGK 479 + + H Y+ + PF G R C G+ Sbjct: 125 LPENTENRHPYAYI-PFTAGPRNCIGQ 150 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 62.1 bits (144), Expect = 1e-11 Identities = 35/99 (35%), Positives = 53/99 (53%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERW 404 I E RL P+ P + R+ M I G IP GT V+ + + + A+++ PER+ Sbjct: 4 IRETLRLNPSVPMIGRMAAGDMEIDGVTIPTGTEVMLNIYVMQNDPQYYPDADQFRPERF 63 Query: 405 IKVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 + QEP YS + PF G R C G+RF LE+ +L ++ Sbjct: 64 L--QEPPPYSYL-PFSTGVRSCIGQRFAMLEMKTVLVRL 99 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 60.9 bits (141), Expect = 3e-11 Identities = 46/162 (28%), Positives = 76/162 (46%), Gaps = 9/162 (5%) Frame = +3 Query: 27 LDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAM-----LCSE 191 L M + A + AG ET + ++ F LY L+ PD Q ++ E+ + + Sbjct: 296 LTMNELAAQVFVSFLAGSETSSTTMNFCLYELAKNPDIQGRLREEIERAVEENGGEVTYD 355 Query: 192 DLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREE 365 + + + INE R P L+R+ T+ G H IP TF+ A R E Sbjct: 356 MVMNVQYLDSVINETLRKYPPIESLSRVPMRDYTVPGTKHVIPKDTFIQIPVYALHRDPE 415 Query: 366 NFWRAEEYLPERWI--KVQEPHAYSLVAPFGRGRRMCPGKRF 485 + +++ P+R++ +V++ H Y + PFG G R+C G RF Sbjct: 416 FYPEPDQFNPDRFLPEEVKKRHPYVFL-PFGEGPRICIGLRF 456 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 56.8 bits (131), Expect = 4e-10 Identities = 43/161 (26%), Positives = 69/161 (42%), Gaps = 8/161 (4%) Frame = +3 Query: 27 LDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAM-----LCSE 191 + M + A + F AG ET + ++ F LY L+ PD Q ++ E+ L + Sbjct: 297 MTMNELAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYD 356 Query: 192 DLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREE 365 + G + ++E R P + R + T+ G H IP GT + A + Sbjct: 357 VVMGTEYLNWVVDETLRKYPPLETVTRAPEHDYTVPGTAHVIPKGTMIQIPIYALHHDAQ 416 Query: 366 NFWRAEEYLPERWI-KVQEPHAYSLVAPFGRGRRMCPGKRF 485 + E + PER+ +V + PFG G R+C G RF Sbjct: 417 YYPDPERFDPERFRPEVANARPAYVYMPFGEGPRICIGLRF 457 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 56.4 bits (130), Expect = 5e-10 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 8/147 (5%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAMLCSE------DLAGAPSVRAA 224 F+ G +T A +L ++LYLL Q ++ E+ E +L+ + Sbjct: 5 FMFEGHDTTAIALAWMLYLLGTDQTVQERVFLEIDGIMGGDRERHPTMAELSEMRYLECC 64 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERW 404 I E+ RL P+ P L+R L + + I GH IP GT + R + F E++ P+R+ Sbjct: 65 IKESLRLFPSIPILSRTLTTGVDIEGHHIPSGTNAVIMLYQLHRDPQYFPNPEKFYPDRF 124 Query: 405 IKVQEP--HAYSLVAPFGRGRRMCPGK 479 + H YS + PF G R C G+ Sbjct: 125 LPENSTNRHPYSYI-PFTAGPRNCIGQ 150 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 56.4 bits (130), Expect = 5e-10 Identities = 51/176 (28%), Positives = 76/176 (43%), Gaps = 7/176 (3%) Frame = +3 Query: 15 ENPALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPYAML 182 E L + A F AG ET A +L F+L+LL+ P+ Q + + L + Sbjct: 285 EEDPLKFEEVAAQAFVFFFAGFETSATTLTFVLHLLAKHPEVQLEGRECVRDVLAKHDNK 344 Query: 183 CSEDLAGAPSVRA-AINEAFRLLPTAPFLARLLDSPMTI-GGHKIPPGTFVLAHTAAACR 356 S D +NE RL P L R+ P + G +P G V+ A Sbjct: 345 LSYDAVMEMEYLGWIVNETLRLYPPVATLHRITTQPYQLPNGAILPEGVGVILPNLAFHY 404 Query: 357 REENFWRAEEYLPERW-IKVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 + F ++ PER+ +K + +S + PFG G R+C G RF L+ L LA + Sbjct: 405 DPDYFPDPYDFKPERFAVKNDFKNNFSYL-PFGEGPRICIGMRFGLLQTRLGLAML 459 >AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CYP4H16 protein. Length = 151 Score = 55.2 bits (127), Expect = 1e-09 Identities = 40/147 (27%), Positives = 65/147 (44%), Gaps = 8/147 (5%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYA-------MLCSEDLAGAPSVRA 221 F+ G +T + + F + L+ D Q+K+ E+ +L + L + Sbjct: 5 FMFEGHDTTTSGISFTILQLAKHQDVQQKLYEEIDTVLGENAKTIVLTNALLQELKYLDL 64 Query: 222 AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 I E+ RL+P PF+ R L M + G +P GT + + R E F E+++PER Sbjct: 65 VIKESLRLVPPVPFVGRKLLEDMEMNGTVVPAGTTISLNIFCLHRNPEVFPEPEKFIPER 124 Query: 402 WIKVQE-PHAYSLVAPFGRGRRMCPGK 479 + + E P PF G R C G+ Sbjct: 125 FSEANEIPRGPYDYIPFSAGPRNCIGQ 151 >AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 54.8 bits (126), Expect = 2e-09 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 6/90 (6%) Frame = +3 Query: 270 RLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERWIKVQEP------HAY 431 R L I G++IP G + EE A+ + PERW+K + H + Sbjct: 9 RTLQEDTVICGYRIPKGVQCVFPNLVLGTMEEYVSDAQRFKPERWLKPAQGGSGDQLHPF 68 Query: 432 SLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 + + P+G G RMC G+RF +LE+ +LLAK+ Sbjct: 69 ASL-PYGYGARMCLGRRFADLEMQILLAKL 97 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 54.8 bits (126), Expect = 2e-09 Identities = 45/167 (26%), Positives = 71/167 (42%), Gaps = 9/167 (5%) Frame = +3 Query: 27 LDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAMLCS-----E 191 L + + A F AG ET + +L F L+ L+ PD Q ++ +E+ L + Sbjct: 295 LTLDEVAAQAFVFFFAGFETSSTTLSFALFELANNPDIQERVRAEMLEKLQLHDGKITYD 354 Query: 192 DLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIP--PGTFVLAHTAAACRREE 365 L + INE R+ P P L R+ P + G + P T ++ A Sbjct: 355 ALKEMTYLDQVINETLRMYPPVPQLIRVTTQPYKVEGANVSLEPDTMLMIPIYAIHHDAS 414 Query: 366 NFWRAEEYLPERWI--KVQEPHAYSLVAPFGRGRRMCPGKRFVELEL 500 + E + P+R+ H ++ + PFG G R C G RF LE+ Sbjct: 415 IYPDPERFDPDRFALAATHARHTHAFL-PFGDGPRNCIGMRFGLLEV 460 >AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 54.4 bits (125), Expect = 2e-09 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 6/105 (5%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWR--AEEYLPE 398 I EA RL P+ P L R+ + + G+ IP GT L A RR + W AE + P+ Sbjct: 2 ILEALRLCPSGPLLGRVCSEDIEVDGNVIPRGTNFLFSIFALHRRTD-VWGPDAEGFDPD 60 Query: 399 RWI----KVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 R++ + + PHAY APF G R C GKR+ + L+L + Sbjct: 61 RFLPERSQGRHPHAY---APFSMGSRDCIGKRYAIQGMKLVLVHL 102 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 54.0 bits (124), Expect = 3e-09 Identities = 46/176 (26%), Positives = 80/176 (45%), Gaps = 8/176 (4%) Frame = +3 Query: 18 NPALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSEL-----PPYAML 182 NP D+ + I I AG +T A + L+ P Q ++ E+ P + Sbjct: 54 NPFTDI-EVTHNIYSMIAAGNDTTALQVTHTCLFLAMHPAIQERVYREVMDVFPDPDQDI 112 Query: 183 CSEDLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRRE 362 EDL + I E+ RL P+ P +AR + I G IP + ++ + RR+ Sbjct: 113 EVEDLKKLTYMERVIKESLRLAPSGPNIARQTMKDIEIAGVHIPRDSLIVMSIFSMHRRK 172 Query: 363 ENFWR--AEEYLPERWIKVQ-EPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 + W A+ + P+R++ + E + ++ PF G R C G R+ L + ++L+ I Sbjct: 173 D-IWGPDADLFDPDRFLPERSEGRSTNVFIPFSAGSRNCIGGRYAMLSMKVMLSSI 227 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 54.0 bits (124), Expect = 3e-09 Identities = 50/176 (28%), Positives = 75/176 (42%), Gaps = 9/176 (5%) Frame = +3 Query: 15 ENPALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPYAML 182 + +L + A F AG ET + L + LY L+ P+ Q K + L + Sbjct: 285 DEDSLTFNEIAAQAFVFFLAGFETSSTLLTWTLYELALNPEVQEKGRECVREILQKHNGE 344 Query: 183 CSED-LAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHK--IPPGTFVLAHTAAAC 353 S D + + +NE+ R P P R+ + G K + GT V+ A Sbjct: 345 MSYDAVVEMKYLDQILNESLRKYPPVPVHLRVASKDYHVPGTKSVLEAGTAVMIPVHAIH 404 Query: 354 RREENFWRAEEYLPERWIKVQEP--HAYSLVAPFGRGRRMCPGKRFVELELHLLLA 515 E F E++ PER+ QE H Y+ PFG G R+C G RF ++ + LA Sbjct: 405 HDPEVFPNPEQFDPERFSPEQEAKRHPYAWT-PFGEGPRICVGLRFGMMQARIGLA 459 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 53.2 bits (122), Expect = 5e-09 Identities = 42/150 (28%), Positives = 68/150 (45%), Gaps = 9/150 (6%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAM-----LCSEDLAGAPSVRAAI 227 F AG ET + + F LY L+ PD Q ++ E+ + + + + I Sbjct: 311 FFLAGFETSSTTQSFCLYELAKNPDIQERLREEINRAIAENGGEVTYDVVMNIKYLDNVI 370 Query: 228 NEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 +E R P L R+ I G H IP T V A R +++ E + P+R Sbjct: 371 DETLRKYPPVESLTRVPSVDYLIPGTKHVIPKRTLVQIPAYAIQRDPDHYPDPERFNPDR 430 Query: 402 WI--KVQEPHAYSLVAPFGRGRRMCPGKRF 485 ++ +V++ H ++ + PFG G R+C G RF Sbjct: 431 FLPEEVKKRHPFTFI-PFGEGPRICIGLRF 459 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 52.8 bits (121), Expect = 7e-09 Identities = 41/148 (27%), Positives = 61/148 (41%), Gaps = 9/148 (6%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPP-------YAMLCSEDLAGAPSVRA 221 F+ G +T + + F Y L+ P+ Q K++ EL + L L P + Sbjct: 5 FMFEGHDTTTSGIAFTFYRLAKHPEIQEKLHQELQDVLGVDYRHVPLTYNTLQNFPYLDM 64 Query: 222 AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 + E+ RLLP F+ R L + + G IP GT R F E + PER Sbjct: 65 VVKESLRLLPPVSFIGRRLVEDIQMNGVTIPAGTDFTIPIYVIHRNPAVFPDPERFDPER 124 Query: 402 WIKVQE--PHAYSLVAPFGRGRRMCPGK 479 + + P Y + PF G R C G+ Sbjct: 125 FSGANQHPPGPYDYI-PFTAGPRNCIGQ 151 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 51.2 bits (117), Expect = 2e-08 Identities = 44/164 (26%), Positives = 72/164 (43%), Gaps = 11/164 (6%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPY-AMLCSEDLAGAPSVRAAI 227 F TAG +T + ++ + LY L+ P+ Q + + L Y L E ++ + I Sbjct: 304 FFTAGYDTSSTAMSYTLYELALNPEVQERARECVKQTLQKYDGKLSYEAVSEMSYLEQCI 363 Query: 228 NEAFRLLPTAPFLARLLDSPMTI--GGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 +E R P L R D + G + G ++ A +F E+Y PER Sbjct: 364 SETLRKHPPVAILERNADKDYRLPDSGLLLRRGQKIMIPIYAMHHDPAHFPEPEQYRPER 423 Query: 402 W----IKVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 + + ++P+ Y PFG G R+C G RF ++ L LA + Sbjct: 424 FSPDEVARRDPYCY---LPFGEGPRVCIGMRFGSIQAKLGLASL 464 >AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CYP4C26 protein. Length = 154 Score = 50.4 bits (115), Expect = 4e-08 Identities = 39/148 (26%), Positives = 65/148 (43%), Gaps = 9/148 (6%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAMLCSED----LAGAPSVR---A 221 F+ G +T A ++ ++LYLL PD Q ++ E+ M D +A +R Sbjct: 5 FMFEGHDTTAAAMAWILYLLGAAPDIQERVIQEIDA-VMGTDRDRRPTMAELNEMRYLEC 63 Query: 222 AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 I E RL P+ P + R L + + + IP GT + R F +++ P+ Sbjct: 64 CIKEGLRLYPSIPVIGRRLTEDVRVDNYTIPAGTTAMIVVYELHRDTSVFSNPDKFNPDN 123 Query: 402 WI--KVQEPHAYSLVAPFGRGRRMCPGK 479 ++ H Y+ + PF G R C G+ Sbjct: 124 FLPENCHGRHPYAYI-PFTAGPRNCIGQ 150 >AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CYP4H17 protein. Length = 151 Score = 50.4 bits (115), Expect = 4e-08 Identities = 39/150 (26%), Positives = 65/150 (43%), Gaps = 11/150 (7%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-------AMLCSEDLAGAPSVRA 221 F+ G +T + + F + L+ + Q+K+ E+ +L S L + Sbjct: 5 FMVEGHDTTTSGISFTILQLAKHQEIQQKLYEEIDGMLGAEAKSTVLTSALLQDMKYLDL 64 Query: 222 AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 + E+ RL+P PF+ R L M + G IP G + + R + F E+++PER Sbjct: 65 VVKESLRLVPPVPFIGRKLLEDMEMNGTTIPAGATISLNIFNVHRNPKVFPEPEKFIPER 124 Query: 402 WIKVQE----PHAYSLVAPFGRGRRMCPGK 479 + E P+ Y PF G R C G+ Sbjct: 125 FSDANEIKRGPYDY---IPFSAGPRNCIGQ 151 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 50.4 bits (115), Expect = 4e-08 Identities = 41/160 (25%), Positives = 66/160 (41%), Gaps = 7/160 (4%) Frame = +3 Query: 27 LDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPYAMLCSED 194 + + D A F AG ET + ++ F LY L+ + Q K I + ++ + E Sbjct: 291 ITIEDVAAQAFVFFLAGFETSSTAMSFCLYELALNQELQDKARQNITDVMKQHSSITYEA 350 Query: 195 LAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHK--IPPGTFVLAHTAAACRREEN 368 + + INE+ R P L R ++ + + G A E+ Sbjct: 351 VHEMKYIEMCINESMRKYPPITTLTRRVEKDYRVPDTDKVLQEGIMAAIPVYALHHDPEH 410 Query: 369 FWRAEEYLPERWIKVQEPHAYSLV-APFGRGRRMCPGKRF 485 F E++ P+R+ QE + V PFG G R+C G RF Sbjct: 411 FPNPEQFDPDRFTAEQEAKRHPFVYLPFGEGPRICIGLRF 450 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 50.4 bits (115), Expect = 4e-08 Identities = 45/171 (26%), Positives = 71/171 (41%), Gaps = 8/171 (4%) Frame = +3 Query: 27 LDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPYAMLCSED 194 L + + A F G ET + ++ + LY L+ Q++ + + + L E Sbjct: 290 LSLNEIVAQAFVFFLGGFETSSTTMSYCLYELALNEAIQQRARECVVEAVKKHGGLTYEA 349 Query: 195 LAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKI--PPGTFVLAHTAAACRREEN 368 L P + INE+ R P L R + + G + P G V+ A +N Sbjct: 350 LMDMPYIDQCINESLRKYPPGANLIRQVSQDYRVPGTDVTFPKGMNVMIPVYAIHHDADN 409 Query: 369 FWRAEEYLPERWIK--VQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLA 515 + E Y P+R+ + YS + PFG G R+C RF LE + LA Sbjct: 410 YPDPERYDPDRFAPEACESRKPYSFI-PFGEGPRICIAARFGMLEARVGLA 459 >AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 protein. Length = 147 Score = 50.0 bits (114), Expect = 5e-08 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%) Frame = +3 Query: 18 NPALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AML 182 +P L D + + F+ G +T + + L+LL+ P+ Q +++ E+ Sbjct: 32 SPLLTDEDVREEVDTFMFEGHDTTTAGMSWALFLLALHPEVQERVHQEIDSIFGGSDRPA 91 Query: 183 CSEDLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAH 338 +DL + + E RL P+ F R +T+GG+ +P GT V H Sbjct: 92 TMQDLTAMRLLERCLKETLRLYPSVAFFGRTTSKDVTLGGYHVPAGTIVGIH 143 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 50.0 bits (114), Expect = 5e-08 Identities = 39/152 (25%), Positives = 63/152 (41%), Gaps = 9/152 (5%) Frame = +3 Query: 93 NSLVFLLYLLSGRPDWQRKINSELPP-------YAMLCSEDLAGAPSVRAAINEAFRLLP 251 + + F Y L+ P+ Q K+ E+ + L L P + + E+ RLLP Sbjct: 6 SGISFTFYQLAKHPEIQEKLYREIQDVLGGEYRHVPLTYNTLQNFPYLDMVVKESLRLLP 65 Query: 252 TAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERWI--KVQEPH 425 F+ R L + + G IP GT R + E + PER+ Q Sbjct: 66 PVSFIGRRLADDIEMNGVTIPAGTDFTIPIYVIHRNPVVYPDPERFDPERFSDGNTQRRG 125 Query: 426 AYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 Y + PF G R C G+R+ LE+ + + ++ Sbjct: 126 PYDYI-PFSIGSRNCIGQRYALLEMKVAIVRM 156 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 49.6 bits (113), Expect = 6e-08 Identities = 45/165 (27%), Positives = 78/165 (47%), Gaps = 9/165 (5%) Frame = +3 Query: 48 AAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINS----ELPPYAMLCSEDLAGAPSV 215 AA + A ET A + + LY L+ RP+ Q++ + L + + E +A P + Sbjct: 291 AAQVFLFVAAYETNAITTFYCLYELAQRPELQQRARACVCEALEKHGGITYEAIAQMPYL 350 Query: 216 RAAINEAFRLLPTAPFLARLL--DSPMTIG-GHKIPPGTFVLAHTAAACRREENFWRAEE 386 INE R P A L R++ D P+ G +P G ++ A +++ E Sbjct: 351 DQCINETLRKHPLAINLIRVVTEDYPVPDSTGIVLPKGLNIIVPVYAIHYDPQHYPEPER 410 Query: 387 YLPERWIK--VQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLA 515 + P+R+ ++ Y+ + PFG G ++C G R +L+L +LA Sbjct: 411 FDPDRFTPEGCRQRAPYTFL-PFGAGPKICIGYRQGKLQLRTMLA 454 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 48.8 bits (111), Expect = 1e-07 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 3/130 (2%) Frame = +3 Query: 141 QRKINSELPPYAMLCSEDLAGAPSVRAAINEAFRLLPTAPF-LARLLDSPMTIGGHKIPP 317 QR+I+ + + +D A + EA R+ P +A + T+ G+ +P Sbjct: 30 QREIDEVVGHGRLPTLDDRTQLAYTEATLREAMRIDTLVPSGIAHRVQEDTTLRGYDLPK 89 Query: 318 GTFVLAHTAAACRREENFWRAEEYLPERWIKVQEPHAYS--LVAPFGRGRRMCPGKRFVE 491 T VL A + E + E + PER++ A + L PFG G+R+C G+ F Sbjct: 90 DTLVLIGLDAIHNQREYWGDPERFRPERFLDEHGRLALAKDLSVPFGAGKRLCAGETFAR 149 Query: 492 LELHLLLAKI 521 + L LA + Sbjct: 150 NIMFLTLAAL 159 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 48.8 bits (111), Expect = 1e-07 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 11/150 (7%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSEL------PPYAMLCSEDLAGAPSVRAA 224 F+ G +T ++ F L LL+ P+ Q ++ E+ P +L + Sbjct: 5 FMFEGHDTTTIAISFTLLLLARHPEVQERVYREVVAIVGNDPATPATHRNLQDMKYLELV 64 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHKIPPGT-----FVLAHTAAACRREENFWRAEEY 389 I E+ RL P P +AR + +GG +P G+ + H + + E + Sbjct: 65 IKESLRLYPPVPIIARRFTENVELGGKIVPEGSNFNIGIMHMHRDPTLFPDPERFDPERF 124 Query: 390 LPERWIKVQEPHAYSLVAPFGRGRRMCPGK 479 P+R ++ P+AY PF G R C G+ Sbjct: 125 APDRTMEQSSPYAY---VPFTAGPRNCIGQ 151 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 48.4 bits (110), Expect = 1e-07 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 2/101 (1%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERW 404 I E+ RL P P +AR+ + +I GT V ++ F AE + P+R+ Sbjct: 45 IKESLRLFPPVPVIARIATEDTELLAERITRGTSVAIDIYTMHHSDDYFPDAERFDPDRF 104 Query: 405 IKVQEPHAYS--LVAPFGRGRRMCPGKRFVELELHLLLAKI 521 ++ ++ PF G R C G++F + EL L K+ Sbjct: 105 EGARDAQTFNPYTYIPFSAGSRNCIGQKFAQYELKSTLVKL 145 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 48.4 bits (110), Expect = 1e-07 Identities = 48/176 (27%), Positives = 73/176 (41%), Gaps = 9/176 (5%) Frame = +3 Query: 15 ENPALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPY-AM 179 ++ L + A F AG ET + L F LY L+ + Q K + L + Sbjct: 225 DDGTLTFNEIAAQAFVFFLAGFETSSTLLTFTLYELALNQEVQDKGRRCVKEVLAKHNGE 284 Query: 180 LCSEDLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHK--IPPGTFVLAHTAAAC 353 L + + + + E+ R P P R + G K + GT V+ A Sbjct: 285 LTYDAVMEMNYLDQILKESLRKYPPVPVHFRETSKEYQVPGTKTVLEAGTSVMVPVHAIH 344 Query: 354 RREENFWRAEEYLPERWIKVQEP--HAYSLVAPFGRGRRMCPGKRFVELELHLLLA 515 R E+F E + P+R+ QE H Y+ PFG G R+C G RF ++ + LA Sbjct: 345 RDPEHFPDPERFDPDRFTAEQEAKRHPYAWT-PFGEGPRICIGLRFGMMQARIGLA 399 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 48.4 bits (110), Expect = 1e-07 Identities = 47/185 (25%), Positives = 80/185 (43%), Gaps = 13/185 (7%) Frame = +3 Query: 6 KILENPALDMRDKK--AAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYA- 176 KIL + + + + A + F AG +T+A S+ F+LY ++ P+ Q+++ E+ + Sbjct: 309 KILPEDMVKLSENEMIAQCLLFFLAGFDTIATSMTFVLYEVTLAPEIQQRLYEEIQQVSE 368 Query: 177 -----MLCSEDLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHK---IPPGTFVL 332 L + L G + ++E R +P R+ + TI G IP G V Sbjct: 369 TLDGKALTYDALQGMRYLDMVVSETLRKWSPSPGTDRMCNQDYTIPGDPDIVIPKGATVF 428 Query: 333 AHTAAACRREENFWRAEEYLPERWIKVQEPHAYSLVA--PFGRGRRMCPGKRFVELELHL 506 A + + + PER+ + H L A PFG G R C RF +E+ Sbjct: 429 IPIAGLHYDPRFYPDPDRFDPERF-NDENKHKIPLGAYLPFGIGPRNCIASRFALMEVKA 487 Query: 507 LLAKI 521 ++ I Sbjct: 488 IVYHI 492 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 47.2 bits (107), Expect = 3e-07 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 9/148 (6%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AMLCSEDLAGAPSVRAAI 227 F+ G +T A F+L LL Q ++ +EL D + I Sbjct: 5 FMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVI 64 Query: 228 NEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 65 FETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDN 124 Query: 402 WI--KVQEPHAYSLVAPFGRGRRMCPGK 479 ++ + Q H YS + PF G R C G+ Sbjct: 125 FLPERTQNRHYYSYI-PFTAGPRNCIGQ 151 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 47.2 bits (107), Expect = 3e-07 Identities = 45/174 (25%), Positives = 72/174 (41%), Gaps = 9/174 (5%) Frame = +3 Query: 24 ALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AMLCS 188 AL + A + F AG ET ++ F L+ LS P+ K+ E+ + Sbjct: 283 ALTIEQCAANVFLFYIAGAETSTATISFTLHELSHNPEAMAKLQQEIDEMMERYNGEITY 342 Query: 189 EDLAGAPSVRAAINEAFRLLPTAPFLAR--LLDSPMTIGGHKIPPGTFVLAHTAAACRRE 362 E++ + + E R P P L R +D + I GT V+ + E Sbjct: 343 ENIKEMKYLDLCVKETLRKYPGLPILNRECTIDYKVPDSDVVIRKGTQVIIPLLSISMNE 402 Query: 363 ENFWRAEEYLPERWIKVQEPHAYSLVAPFGRGRRMCPGKRFV--ELELHLLLAK 518 + F E Y PER+ + + + PFG G R C G+ + ++ L LL+K Sbjct: 403 KYFPDPELYSPERFDEATKNYDADAYYPFGAGPRNCIGQGVLVSKIGLVFLLSK 456 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 46.8 bits (106), Expect = 4e-07 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 12/66 (18%) Frame = +3 Query: 360 EENFWRAEEYLPERWIKVQE-------PHAYSLV-----APFGRGRRMCPGKRFVELELH 503 ++ F + ++PERW+K E PHA + PFG GRR C G+RF E EL Sbjct: 10 QQYFPEPDRFVPERWLKRGELKEHSGCPHAGQKIHPYVSLPFGYGRRTCIGRRFAECELQ 69 Query: 504 LLLAKI 521 +LL+K+ Sbjct: 70 ILLSKL 75 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 46.8 bits (106), Expect = 4e-07 Identities = 48/176 (27%), Positives = 74/176 (42%), Gaps = 11/176 (6%) Frame = +3 Query: 24 ALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AMLCS 188 AL + A + F AG ET ++ F L+ LS P+ K+ E+ + Sbjct: 283 ALSIEQCAANVFLFYIAGAETSTATISFTLHELSHNPEAMAKLQQEIDEMMERYNGEITY 342 Query: 189 EDLAGAPSVRAAINEAFRLLPTAPFLAR--LLDSPMTIGGHKIPPGTFVLAHTAAACRRE 362 E++ + + E R P P L R +D + I GT V+ + E Sbjct: 343 ENIKEMKYLDLCVKETLRKYPGLPILNRECTIDYKVPDSDVVIRKGTQVIIPLWSISMNE 402 Query: 363 ENFWRAEEYLPERWIKVQEPHAYSLVAPFGRGRRMCPGKR---FV-ELELHLLLAK 518 + F E + PER+ + + + PFG G R C G R FV ++ L LLL+K Sbjct: 403 KYFPDPELHSPERFDEATKNYDADAYYPFGAGPRNCIGLRQGVFVSKIGLVLLLSK 458 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 46.4 bits (105), Expect = 6e-07 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 8/158 (5%) Frame = +3 Query: 72 AGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAMLCSEDLAGAPSVRA------AINE 233 AG ET A ++ + LL+ P Q K+ E+ E G ++ + E Sbjct: 2 AGNETSAMTVANTILLLAMHPHVQEKLVDEIRLQCGAEGEQSIGYETLNRLTYMELVLKE 61 Query: 234 AFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWR--AEEYLPERWI 407 + RLLP A + R + + +G +++P ++ R +W A+ + PER+ Sbjct: 62 SLRLLPIAAVVGRRTTAEVDLGQYRLPADIDIVIDIFDI-HRNPAYWGSDADRFRPERFE 120 Query: 408 KVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 ++ H + PF G R C G R+ + + ++L K+ Sbjct: 121 GLR--HDPFALLPFSAGSRNCVGLRYAWISMKIMLLKV 156 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 46.0 bits (104), Expect = 8e-07 Identities = 44/178 (24%), Positives = 72/178 (40%), Gaps = 9/178 (5%) Frame = +3 Query: 15 ENPALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-----AM 179 + + M + A + F AG ET + + F LY L+ P Q ++ EL Sbjct: 295 DRTGMTMNELAAQVFIFFVAGFETSSTVMNFCLYELAKNPHIQERLRDELNRSIDANGGE 354 Query: 180 LCSEDLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAAC 353 L + + G + +NE R P R+ TI G H IP V A Sbjct: 355 LTYDMVMGHEYLGQVVNETLRKYPPLETTLRVAGQDYTIPGTRHVIPRHVGVQIPVYAIH 414 Query: 354 RREENFWRAEEYLPERWIK--VQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 ++ E + P+R+ + Y+ + PFG G R+C G RF +++ + L + Sbjct: 415 HDPAHYPEPECFDPDRFSAEACRNRTPYTFL-PFGEGPRVCIGMRFGMMQVKVGLVSM 471 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 45.6 bits (103), Expect = 1e-06 Identities = 47/181 (25%), Positives = 74/181 (40%), Gaps = 10/181 (5%) Frame = +3 Query: 3 LKILENP--ALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRK----INSEL 164 L+ ENP AL + A F AG ET + L + LY L+ P+ Q K + L Sbjct: 278 LRDTENPEEALTFNEVAAQAFVFFFAGFETSSTLLTWTLYELALNPEVQEKGRQCVQEVL 337 Query: 165 PPY-AMLCSEDLAGAPSVRAAINEAFRLLPTAPFLARLL--DSPMTIGGHKIPPGTFVLA 335 + + + + + + E+ R P P R+ D + I GT + Sbjct: 338 AKHNGEMTYDAIHDMKYLDQILKESLRKYPPVPMHFRMTAQDYRVPDTDSVIEAGTMLFI 397 Query: 336 HTAAACRREENFWRAEEYLPERWIKVQEPHAYSLV-APFGRGRRMCPGKRFVELELHLLL 512 + R F E++ PER+ +E + PFG G R+C G RF ++ + L Sbjct: 398 PIFSIQRDASLFPEPEKFDPERFSAEEEAKRHPFAWTPFGEGPRVCIGLRFGMMQARIGL 457 Query: 513 A 515 A Sbjct: 458 A 458 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 45.6 bits (103), Expect = 1e-06 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 12/151 (7%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELP---------PYAMLCSEDLAGAPSV 215 F+ G +T +++ FLL+ L+ P Q K+ E+ P M D+ V Sbjct: 5 FMFEGHDTTTSAISFLLHSLAQNPTIQEKVFDEVRNVVGDDRTRPVTMAMLNDMHYLDLV 64 Query: 216 RAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLP 395 I E RL P+ P + R + I G IP G ++ R F E++ P Sbjct: 65 ---IKETLRLYPSVPMIGRKMQQTAEINGKIIPAGANLIIMPFFLGREARYFPEPEKFDP 121 Query: 396 ERW---IKVQEPHAYSLVAPFGRGRRMCPGK 479 ER+ ++ + Y + PF G R C G+ Sbjct: 122 ERFNVERSAEKTNPYQYI-PFSAGPRNCIGQ 151 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 44.0 bits (99), Expect = 3e-06 Identities = 45/173 (26%), Positives = 67/173 (38%), Gaps = 9/173 (5%) Frame = +3 Query: 15 ENPALDMRDKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPY-AM 179 ++ L + A F AG ET ++ + F LY L+ D Q K + L + Sbjct: 225 DDGTLTFHEIAAQAFVFFVAGFETSSSLMAFTLYELALDQDMQDKARKCVTDVLERHNGE 284 Query: 180 LCSEDLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHK--IPPGTFVLAHTAAAC 353 L E + + E R P R+ + G + GT V+ Sbjct: 285 LTYEAAMEMDYLECVLKECLRKHPPISVHFRITAKDYIVPGTTSVLEAGTSVMIPVLGIH 344 Query: 354 RREENFWRAEEYLPERWIKVQEP--HAYSLVAPFGRGRRMCPGKRFVELELHL 506 E+F E + PER+ QE H Y+ PFG G R+C G RF L+ + Sbjct: 345 HDPEHFPEPERFDPERFTAEQESKRHPYAWT-PFGEGPRICVGPRFGLLQARI 396 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 43.6 bits (98), Expect = 4e-06 Identities = 42/162 (25%), Positives = 70/162 (43%), Gaps = 11/162 (6%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRK----INSELPPY-AMLCSEDLAGAPSVRAAI 227 F TAG ET ++++ + LY L+ + QRK + L + ++ E + I Sbjct: 312 FFTAGFETSSSAMTYTLYELALNQEAQRKARECVLEALAKHDGVVSYESSKNMLYLDQCI 371 Query: 228 NEAFRLLPTAPFLARLLDSPMTIGGHKIP--PGTFVLAHTAAACRREENFWRAEEYLPER 401 E R P L R++ P I + PG ++ A + + Y P+R Sbjct: 372 YETLRKYPPVAILERIVTKPYRIPDTSVTLHPGMKIMIPAYAIHHDPDIYPEPATYDPDR 431 Query: 402 W----IKVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLA 515 + + ++P AY PFG G R+C G RF ++ + LA Sbjct: 432 FTPERMARRDPCAY---LPFGEGPRICIGLRFGMMQARIGLA 470 >AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 protein. Length = 155 Score = 43.2 bits (97), Expect = 5e-06 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 2/110 (1%) Frame = +3 Query: 189 EDLAGAPSVRAAINEAFRLLPTAPF-LARLLDSPMTIGGHKIPPGTFVLAHTAAACRREE 365 ED A P A E RL + F + T+ G+ IP T +L +E Sbjct: 27 EDRASMPYSEATTLEGLRLFMSNTFGIPHRALKDTTLCGYHIPKDT-MLVGMFRGMMLDE 85 Query: 366 NFWR-AEEYLPERWIKVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLL 512 N W ++ PER++K + H + PFG G+ C G+ + L L L Sbjct: 86 NLWENPTQFNPERFLKDGKIHIPAQYHPFGVGKHRCMGELMAKSNLFLFL 135 >AY748837-1|AAV28185.1| 97|Anopheles gambiae cytochrome P450 protein. Length = 97 Score = 43.2 bits (97), Expect = 5e-06 Identities = 19/59 (32%), Positives = 33/59 (55%) Frame = +3 Query: 195 LAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENF 371 +A A RA + E RL P + + R+L+ +GG+++P GT ++ +CR+E F Sbjct: 32 IAEASYCRAVLKETLRLNPISIGVGRILNRDHVLGGYQVPRGTVIVTQNMISCRQEAYF 90 >AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CYP4H14 protein. Length = 151 Score = 43.2 bits (97), Expect = 5e-06 Identities = 34/147 (23%), Positives = 58/147 (39%), Gaps = 8/147 (5%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPY-------AMLCSEDLAGAPSVRA 221 F+ G +T + + F +Y L+ PD Q ++ E+ A L ++L + Sbjct: 5 FMFEGHDTTTSGISFTIYELARNPDVQERVYEEIVSILGKDHKTAELTYQNLQEFKYLDL 64 Query: 222 AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPER 401 + E R+ P + R L + + G +P G VL R E + ++ P R Sbjct: 65 VVKEGLRMYPPVGIIGRALVEDLELNGTTVPAGQNVLVPIYVIHRNPEIYPNPNQFDPSR 124 Query: 402 WIKVQEPHAYSL-VAPFGRGRRMCPGK 479 + + E PF G R C G+ Sbjct: 125 FAEDAESKRGPFDYLPFSAGPRNCIGQ 151 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 43.2 bits (97), Expect = 5e-06 Identities = 40/151 (26%), Positives = 64/151 (42%), Gaps = 12/151 (7%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSEL---------PPYAMLCSEDLAGAPSV 215 F+ G +T +++ F+L+ L+ PD Q K +E+ P M D+ V Sbjct: 5 FMFEGHDTTTSAISFMLHSLAQNPDVQEKAFNEVRNIVGDDRKQPVTMAMLNDMHYLDLV 64 Query: 216 RAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLP 395 I E RL P+ P R + I G P G+ V+ R + F E++ P Sbjct: 65 ---IKETLRLYPSVPLFGRKMLQNTEINGKIFPAGSNVIVLPFFMGRDPDCFANPEKFDP 121 Query: 396 ERW---IKVQEPHAYSLVAPFGRGRRMCPGK 479 ER+ ++ + Y + PF G R C G+ Sbjct: 122 ERFNVERSAEKTNPYQYI-PFTAGPRNCIGQ 151 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 42.7 bits (96), Expect = 7e-06 Identities = 35/152 (23%), Positives = 61/152 (40%), Gaps = 7/152 (4%) Frame = +3 Query: 48 AAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSELPP-----YAMLCSEDLAGAPS 212 A + F AG +T ++ F L+ L+ + K+ E+ + + +++ G Sbjct: 291 ANVFLFYGAGADTSTGTITFTLHELTHNAEAMAKLQREVDEMMERHHGEITYDNITGMKY 350 Query: 213 VRAAINEAFRLLPTAPFLAR--LLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEE 386 + + E R+ P L R +D + I GT ++ E+ F E Sbjct: 351 LDLCVKETLRIYPALAVLNRECTIDYKVPDSDTVIRKGTQMIIPLLGISMNEKYFPEPEL 410 Query: 387 YLPERWIKVQEPHAYSLVAPFGRGRRMCPGKR 482 Y PER+ + + + PFG G R C G R Sbjct: 411 YSPERFDEATKNYDADAYYPFGAGPRNCIGLR 442 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 41.5 bits (93), Expect = 2e-05 Identities = 40/151 (26%), Positives = 62/151 (41%), Gaps = 12/151 (7%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELP---------PYAMLCSEDLAGAPSV 215 F+ G +T +++ FLL L+ P Q+K+ E+ P + D+ V Sbjct: 5 FMFEGHDTTTSAISFLLQNLAKHPAIQQKVFDEVRNVVGDDRTRPVTIAMLNDMHYLDLV 64 Query: 216 RAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLP 395 I E RL P+ P R + I G P G+ + R E F E++ P Sbjct: 65 ---IKETLRLYPSVPMFGRKMMEDAEINGKVFPAGSNTIILPFFLGRNPEFFPNPEKFDP 121 Query: 396 ERW---IKVQEPHAYSLVAPFGRGRRMCPGK 479 ER+ ++ + Y V PF G R C G+ Sbjct: 122 ERFNVETSAEKTNPYQYV-PFSAGPRNCIGQ 151 >AY062195-1|AAL58556.1| 139|Anopheles gambiae cytochrome P450 CYP4H18 protein. Length = 139 Score = 39.9 bits (89), Expect = 5e-05 Identities = 33/129 (25%), Positives = 52/129 (40%), Gaps = 10/129 (7%) Frame = +3 Query: 63 FITAGIETLANSLVFLLYLLSGRPDWQRKINSELPPYAMLCSEDLAGAPSVRA------- 221 F+ G +T + + F + L+ D Q+++ E+ + E+ P A Sbjct: 5 FMFEGHDTTTSGISFTILHLAKHQDVQQRLYEEID---RMLGEEKTNVPLTNALLQDFKY 61 Query: 222 ---AINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYL 392 I E+ RL+P P + R L M I G IP GT + R F E + Sbjct: 62 LDMVIKESLRLVPPVPIIGRKLLEDMEINGAIIPAGTSISIKIFNIHRNRTVFPEPERFD 121 Query: 393 PERWIKVQE 419 PER+ + E Sbjct: 122 PERFSEANE 130 >AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 38.3 bits (85), Expect = 2e-04 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 6/103 (5%) Frame = +3 Query: 189 EDLAGAPSVRAAINEAFRLLPTAPF-LARLLDSPMTIGGHKIPPGTFVLAHTAAACRREE 365 +D P A + EA R+ P + + + + G +IP GT ++ +E+ Sbjct: 1 DDRTHLPYCEAVVREALRIDTLVPSGIPHVATADTELAGFQIPKGTLIINGLDYINHQED 60 Query: 366 NFWRAEEYLPERWIK---VQEPHA--YSLVAPFGRGRRMCPGK 479 F + PER++ Q+ A + PFG G+R+C G+ Sbjct: 61 VFPEPHTFRPERFLSDDGQQQQLALEHDRSVPFGAGKRVCAGE 103 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 37.5 bits (83), Expect = 3e-04 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 4/83 (4%) Frame = +3 Query: 249 PTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPERWI--KVQ 416 P L R S I G H +P T V A R +++ E + P+R++ +V+ Sbjct: 1 PPVETLTRKPSSDYVIPGTRHIVPKDTVVQIPIYAIQRDPDHYPDPERFDPDRFLPEEVK 60 Query: 417 EPHAYSLVAPFGRGRRMCPGKRF 485 + H Y + PFG G R+C G RF Sbjct: 61 KRHPYVFL-PFGEGPRICIGLRF 82 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 34.3 bits (75), Expect = 0.003 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWIKVQEPHA 428 ++ + +A Sbjct: 160 NFLPERTQNA 169 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 34.3 bits (75), Expect = 0.003 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWIKVQEPHA 428 ++ + +A Sbjct: 160 NFLPERTQNA 169 >AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 protein. Length = 107 Score = 34.3 bits (75), Expect = 0.003 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = +3 Query: 312 PPGTFVLAHTAAACRREENFWRAEEYLPERW---IKVQEPHAYSLVAPFGRGRRMCPGKR 482 P GT ++ A R E + E + PER+ Q P+A+ PF G R C G + Sbjct: 1 PTGTEIMILPYATHRLEHIYPDPERFDPERFGDGAPHQNPYAF---LPFSAGPRNCIGYK 57 Query: 483 FVELELHLLLAKI 521 F +E+ ++A++ Sbjct: 58 FAYIEMKTVIARV 70 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 89 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 148 Query: 399 RWI 407 ++ Sbjct: 149 NFL 151 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 89 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 148 Query: 399 RWI 407 ++ Sbjct: 149 NFL 151 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 89 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 148 Query: 399 RWI 407 ++ Sbjct: 149 NFL 151 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 89 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 148 Query: 399 RWI 407 ++ Sbjct: 149 NFL 151 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 92 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 151 Query: 399 RWI 407 ++ Sbjct: 152 NFL 154 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 92 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 151 Query: 399 RWI 407 ++ Sbjct: 152 NFL 154 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 103 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 162 Query: 399 RWI 407 ++ Sbjct: 163 NFL 165 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 103 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 162 Query: 399 RWI 407 ++ Sbjct: 163 NFL 165 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 89 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 148 Query: 399 RWI 407 ++ Sbjct: 149 NFL 151 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 89 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 148 Query: 399 RWI 407 ++ Sbjct: 149 NFL 151 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 103 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 162 Query: 399 RWI 407 ++ Sbjct: 163 NFL 165 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 103 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 162 Query: 399 RWI 407 ++ Sbjct: 163 NFL 165 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 103 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 162 Query: 399 RWI 407 ++ Sbjct: 163 NFL 165 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 103 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 162 Query: 399 RWI 407 ++ Sbjct: 163 NFL 165 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 88 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 147 Query: 399 RWI 407 ++ Sbjct: 148 NFL 150 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 88 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 147 Query: 399 RWI 407 ++ Sbjct: 148 NFL 150 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 101 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 160 Query: 399 RWI 407 ++ Sbjct: 161 NFL 163 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 102 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 161 Query: 399 RWI 407 ++ Sbjct: 162 NFL 164 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 102 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 161 Query: 399 RWI 407 ++ Sbjct: 162 NFL 164 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 33.9 bits (74), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGG--HKIPPGTFVLAHTAAACRREENFWRAEEYLPE 398 I E R+ P P +AR ++ + + + IP GT V+ T RRE+ + E + P+ Sbjct: 100 IFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPD 159 Query: 399 RWI 407 ++ Sbjct: 160 NFL 162 >AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 protein. Length = 102 Score = 32.7 bits (71), Expect = 0.008 Identities = 23/74 (31%), Positives = 32/74 (43%) Frame = +3 Query: 300 GHKIPPGTFVLAHTAAACRREENFWRAEEYLPERWIKVQEPHAYSLVAPFGRGRRMCPGK 479 G I GT++L H E F +++ PER+ + PF G R C G+ Sbjct: 6 GSTIVFGTYMLHHNP------EYFPEPDQFRPERFADGETKRNPFAYIPFSAGSRNCIGQ 59 Query: 480 RFVELELHLLLAKI 521 +F EL L KI Sbjct: 60 KFALNELKTALVKI 73 >AY745217-1|AAU93484.1| 98|Anopheles gambiae cytochrome P450 protein. Length = 98 Score = 31.9 bits (69), Expect = 0.013 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 4/98 (4%) Frame = +3 Query: 159 ELPPYAMLCSEDLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAH 338 ++ P+ + EDL + + E RLLP +AR + +P G FVL Sbjct: 2 DVVPHGPVSYEDLTKLTLLEMFLKETMRLLPITGLIARTPMKEVQAQDVTLPVGCFVLI- 60 Query: 339 TAAACRREENFW--RAEEYLPERWI--KVQEPHAYSLV 440 R++ W AE + P+ ++ + + H Y+ + Sbjct: 61 PFLKMHRDKTIWGPDAETFNPDNFLPERCAQRHPYAFI 98 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 31.5 bits (68), Expect = 0.018 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 7/92 (7%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFW-RAEEYLPER 401 + F ++P + L D ++GG+++P T VL + ++W E + PER Sbjct: 6 VQRFFHIVPVSGPRRTLADC--SLGGYRVPKDTTVLIGLRTV-HMDRDYWGDPEVFRPER 62 Query: 402 WIKVQ-----EPHAYS-LVAPFGRGRRMCPGK 479 +++ + +PH ++ + FG G+R C G+ Sbjct: 63 FLESERDTAGKPHLHTDRLMFFGIGKRRCLGE 94 >AY748851-1|AAV28197.1| 98|Anopheles gambiae cytochrome P450 protein. Length = 98 Score = 29.9 bits (64), Expect = 0.054 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 39 DKKAAIIDFITAGIETLANSLVFLLYLLSGRPDWQRKINSEL 164 D A F GIET L F Y L+ PD Q ++ +E+ Sbjct: 14 DIAGAAASFFFGGIETTTTLLCFTSYELAVNPDIQERLRAEI 55 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 29.9 bits (64), Expect = 0.054 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 4/75 (5%) Frame = +3 Query: 309 IPPGTFVLAHTAAACRREENFWRAEEYLPERWIKVQE-PHAY---SLVAPFGRGRRMCPG 476 + GT V+ + C E+F +Y P+R+ AY + PFG G RMC G Sbjct: 9 VKKGTTVVLPYYSICFDAEHFADPYKYDPKRFAAENGGSKAYRERGVYFPFGDGPRMCLG 68 Query: 477 KRFVELELHLLLAKI 521 RF ++ + ++ Sbjct: 69 MRFAVTQVRRAIVEV 83 >AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 29.5 bits (63), Expect = 0.072 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 444 PFGRGRRMCPGKRFVELELHLLLAKI 521 PF G R C G++ +L++H LL+ I Sbjct: 26 PFAIGARSCIGQKIAQLQMHYLLSMI 51 >AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 protein. Length = 99 Score = 29.1 bits (62), Expect = 0.095 Identities = 28/96 (29%), Positives = 36/96 (37%), Gaps = 9/96 (9%) Frame = +3 Query: 225 INEAFRLLPTAPFLARLLDSPMTIGGHK--------IPPGTFVLAHTAAACRREENFWRA 380 I+E RL P F+ R P G+K IP G ++ A R + F Sbjct: 2 ISETNRLYPVLAFIERQCTLPEGSTGYKLEPLHDYVIPNGMPIMIPIYAIHRDPKYFPNP 61 Query: 381 EEYLPERWIKVQEPHAYSLV-APFGRGRRMCPGKRF 485 + PER+ K PFG G R C G F Sbjct: 62 TVFDPERFAKENLDQIQPCTYMPFGVGPRTCLGSHF 97 >AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 28.7 bits (61), Expect = 0.13 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 309 IPPGTFVLAHTAAACRREENFWRAEEYLPERWIKVQEPHAYSLVAPFGRGRRMCPGKR 482 I GT V+ E+ F E Y+P+R+ + + PFG G R C G R Sbjct: 3 IRAGTQVIIPLLGISMDEKYFPEPEVYMPQRFDEQAPNYDPDAYYPFGLGPRNCIGLR 60 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 27.5 bits (58), Expect = 0.29 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -2 Query: 271 LARNGAVGNSLKASLIAALTEGAPAKSSEQSIAYGGSSELI 149 LA++GAV + L+ S++AAL E S + +A G +++ Sbjct: 105 LAKHGAVQDRLRGSIVAALDETDGQLSYDMVMALGYLDQVV 145 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 27.1 bits (57), Expect = 0.38 Identities = 25/115 (21%), Positives = 44/115 (38%), Gaps = 5/115 (4%) Frame = +3 Query: 192 DLAGAPSVRAAINEAFRLLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENF 371 D P A I E R ++P + + I G+ + GT V + E + Sbjct: 16 DTESMPYTVATIFEVLRY-SSSPIVPHVATEDTCIAGYGVTKGTVVFINNYELNTSERYW 74 Query: 372 WRAEEYLP----ERWIKVQEPHA-YSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 + + P ER ++++ PF G+R C G+ V +++A I Sbjct: 75 SEPKRFNPSRENERTLQIERVRKNIPHFLPFSIGKRTCIGQNLVRGFSFIIIANI 129 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 26.6 bits (56), Expect = 0.50 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +3 Query: 318 GTFVLAHTAAACRREENFWRAEEYLPERWIKVQE-PHAYSLVAPFGRGRRMCPG 476 GT +L A + + ++ PER+ ++ H + PFG G RMC G Sbjct: 32 GTPILIPVLAIHMDPKYYPEPHQFDPERFSPARKVTHEGATFLPFGEGPRMCLG 85 >AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 26.2 bits (55), Expect = 0.67 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 366 NFWRAEEYLPERWIKVQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAKI 521 N + + +LPER H Y + PF G R C G R+ + + ++L + Sbjct: 29 NAFDPDNFLPER---TAHRHPYCFL-PFSAGPRNCIGYRYGLMSMKVMLCHL 76 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 25.8 bits (54), Expect = 0.88 Identities = 18/60 (30%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +3 Query: 309 IPPGTFVLAHTAAACRREENFWRAEEYLPERWIKVQEPHAY-SLVAPFGRGRRMCPGKRF 485 I GT V + F E + PER+ + PFG G R C G RF Sbjct: 44 IEKGTLVFIPVVGIHFDPKYFPEPERFDPERFSAANRNNIQPGTYLPFGAGPRNCIGSRF 103 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 514 ASNKCSSSSTNRFPGHILRPRPNGATSE 431 +S S SS N FP H++ P+G E Sbjct: 245 SSTSKSISSANSFPMHVVSSAPSGMHEE 272 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +1 Query: 16 KTQHWTCATRRLPLSTS*LPVLRR*PTVWCFSCTY*VDVQIGK 144 + + T +R P PV+ PT WC Y +++++G+ Sbjct: 285 QNDNMTDLSRMSPSEMDTQPVMYHEPTFWCSISYYELNLRVGE 327 >AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 protein. Length = 83 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 444 PFGRGRRMCPGKRFVELEL 500 PFG G R C G RF +++ Sbjct: 30 PFGDGPRQCLGMRFALMQV 48 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 147 FFANLDVHSVGTGETPNCWLASQY 76 FF+ DVH+ G +C +A Q+ Sbjct: 159 FFSTDDVHAAGNWGMKDCVMALQW 182 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 243 LLPTAPFLARLLDSPMTIGGH-KIPP 317 +LP L +L+D +T+ GH K+ P Sbjct: 279 MLPITLVLTQLIDETVTVLGHAKVSP 304 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,072 Number of Sequences: 2352 Number of extensions: 12265 Number of successful extensions: 152 Number of sequences better than 10.0: 120 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -