BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302G08f (509 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U95171-1|AAB51540.1| 1861|Drosophila melanogaster microtubule as... 30 1.6 AY094825-1|AAM11178.1| 877|Drosophila melanogaster LD39479p pro... 30 1.6 AE014297-3620|AAF56330.3| 1954|Drosophila melanogaster CG6875-PA... 30 1.6 >U95171-1|AAB51540.1| 1861|Drosophila melanogaster microtubule associated protein protein. Length = 1861 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = -1 Query: 428 ITRNNFYQKGLSVEKNLYKIYTAIKCNLNRLKLFQSYKRIKNASYLEASRYLRIKQYI-N 252 I RN++Y S+ KN+ + ++ + + ++Y R++NAS L RY +Q I + Sbjct: 1123 IDRNHYY----SLRKNVICLQQRLRAIMKMREQRENYLRLRNASILVQKRYRMRQQMIQD 1178 Query: 251 RNTH 240 RN + Sbjct: 1179 RNAY 1182 >AY094825-1|AAM11178.1| 877|Drosophila melanogaster LD39479p protein. Length = 877 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = -1 Query: 428 ITRNNFYQKGLSVEKNLYKIYTAIKCNLNRLKLFQSYKRIKNASYLEASRYLRIKQYI-N 252 I RN++Y S+ KN+ + ++ + + ++Y R++NAS L RY +Q I + Sbjct: 490 IDRNHYY----SLRKNVICLQQRLRAIMKMREQRENYLRLRNASILVQKRYRMRQQMIQD 545 Query: 251 RNTH 240 RN + Sbjct: 546 RNAY 549 >AE014297-3620|AAF56330.3| 1954|Drosophila melanogaster CG6875-PA protein. Length = 1954 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = -1 Query: 428 ITRNNFYQKGLSVEKNLYKIYTAIKCNLNRLKLFQSYKRIKNASYLEASRYLRIKQYI-N 252 I RN++Y S+ KN+ + ++ + + ++Y R++NAS L RY +Q I + Sbjct: 1216 IDRNHYY----SLRKNVICLQQRLRAIMKMREQRENYLRLRNASILVQKRYRMRQQMIQD 1271 Query: 251 RNTH 240 RN + Sbjct: 1272 RNAY 1275 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,067,664 Number of Sequences: 53049 Number of extensions: 268123 Number of successful extensions: 383 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1846255872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -