BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302G08f (509 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45700.1 68415.m05682 sterile alpha motif (SAM) domain-contai... 27 9.7 >At2g45700.1 68415.m05682 sterile alpha motif (SAM) domain-containing protein similar to SNM1 protein [Mus musculus] GI:7595835; contains Pfam profile PF00536: SAM domain (Sterile alpha motif) Length = 723 Score = 26.6 bits (56), Expect = 9.7 Identities = 22/71 (30%), Positives = 31/71 (43%) Frame = -1 Query: 464 THILALIYPNLPITRNNFYQKGLSVEKNLYKIYTAIKCNLNRLKLFQSYKRIKNASYLEA 285 +HI +LI + K +V + + + A N L L SY K +LE Sbjct: 520 SHISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAFNPKTLFLIGSYTIGKERLFLEV 579 Query: 284 SRYLRIKQYIN 252 +R LR K YIN Sbjct: 580 ARVLREKIYIN 590 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,487,200 Number of Sequences: 28952 Number of extensions: 135884 Number of successful extensions: 220 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -