BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302G07f (373 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1451 + 33695734-33695806,33695946-33696179,33696341-336964... 29 1.2 09_04_0115 - 14789499-14790288,14792055-14792441,14792820-14793193 26 8.2 >04_04_1451 + 33695734-33695806,33695946-33696179,33696341-33696434, 33696532-33696749,33696859-33696992,33697098-33697325, 33697417-33697845 Length = 469 Score = 29.1 bits (62), Expect = 1.2 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 147 GLLGTFWKCARIGERKSPYVAVCCILMAFSILFLT*NCYK 266 G+L W A++G P VC + + FL +CY+ Sbjct: 42 GVLALSWSVAQLGWVAGPIAMVCFAFVTYISAFLLSHCYR 81 >09_04_0115 - 14789499-14790288,14792055-14792441,14792820-14793193 Length = 516 Score = 26.2 bits (55), Expect = 8.2 Identities = 11/51 (21%), Positives = 27/51 (52%) Frame = -1 Query: 181 ILAHFQNVPSKPVLFRSMILGKNDLR*AQVHINNSNTDKRL*KLNIALILC 29 +L +N+ KP+L + ++GK ++ + + S+ K+L + ++ C Sbjct: 315 LLNRLKNIDGKPILDFTQLVGKFEMTASSMSSKYSSATKKLKRKKTDMVAC 365 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,265,096 Number of Sequences: 37544 Number of extensions: 161449 Number of successful extensions: 240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 588739508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -