BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302G05f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9VAM6 Cluster: CG1458-PA; n=7; Endopterygota|Rep: CG14... 188 9e-47 UniRef50_Q7Z3D5 Cluster: Zinc finger CDGSH domain-containing pro... 120 3e-26 UniRef50_Q15ES6 Cluster: CDGSH-type Zn finger-containing protein... 116 2e-25 UniRef50_A7T1B0 Cluster: Predicted protein; n=2; Nematostella ve... 114 1e-24 UniRef50_UPI0000585E9D Cluster: PREDICTED: hypothetical protein;... 106 3e-22 UniRef50_Q58EB0 Cluster: Zgc:110843; n=2; Danio rerio|Rep: Zgc:1... 104 1e-21 UniRef50_Q9NL51 Cluster: Kinesin like protein; n=5; Caenorhabdit... 101 8e-21 UniRef50_Q9NZ45 Cluster: CDGSH iron sulfur domain-containing pro... 96 4e-19 UniRef50_Q9FLI7 Cluster: Arabidopsis thaliana genomic DNA, chrom... 81 2e-14 UniRef50_Q0D6L9 Cluster: Os07g0467200 protein; n=3; Oryza sativa... 81 2e-14 UniRef50_Q4T7B9 Cluster: Chromosome 1 SCAF8155, whole genome sho... 64 1e-09 UniRef50_Q55GD7 Cluster: Putative uncharacterized protein; n=1; ... 53 3e-06 UniRef50_Q4N2P5 Cluster: Putative uncharacterized protein; n=1; ... 51 2e-05 UniRef50_Q7RKN6 Cluster: Putative uncharacterized protein PY0286... 47 3e-04 UniRef50_A7ATI6 Cluster: Putative uncharacterized protein; n=1; ... 44 0.002 UniRef50_Q962M3 Cluster: PV1H14055_P; n=5; Plasmodium|Rep: PV1H1... 43 0.005 UniRef50_A6UNI4 Cluster: Zinc finger CDGSH-type domain protein; ... 43 0.005 UniRef50_Q54UZ7 Cluster: Putative uncharacterized protein; n=1; ... 41 0.020 UniRef50_Q98DK7 Cluster: Mlr4660 protein; n=2; Alphaproteobacter... 40 0.035 UniRef50_A6TUK3 Cluster: Putative uncharacterized protein; n=1; ... 40 0.035 UniRef50_A4EGN9 Cluster: Putative uncharacterized protein; n=1; ... 40 0.035 UniRef50_Q465J8 Cluster: Putative uncharacterized protein; n=2; ... 39 0.060 UniRef50_Q6LSF0 Cluster: Putative uncharacterized protein CG3420... 39 0.080 UniRef50_Q02RN6 Cluster: Putative uncharacterized protein; n=3; ... 39 0.080 UniRef50_Q8PSP5 Cluster: Conserved protein; n=3; Methanosarcina|... 39 0.080 UniRef50_Q5ZXI8 Cluster: Glutamate synthetase; n=4; Legionella p... 38 0.14 UniRef50_Q18QM0 Cluster: Zinc finger, CDGSH-type; n=2; Desulfito... 38 0.14 UniRef50_Q0W3Y6 Cluster: Putative uncharacterized protein; n=1; ... 38 0.14 UniRef50_A6G5G8 Cluster: Putative uncharacterized protein; n=1; ... 38 0.18 UniRef50_A6DCD1 Cluster: Putative uncharacterized protein; n=1; ... 38 0.18 UniRef50_A3UQB8 Cluster: Glutamate synthase domain protein; n=24... 38 0.18 UniRef50_Q4MMV8 Cluster: Conserved protein; n=16; Bacillaceae|Re... 37 0.24 UniRef50_Q5SME8 Cluster: Putative uncharacterized protein TTHA13... 37 0.32 UniRef50_Q30RV3 Cluster: Zinc finger, CDGSH-type; n=1; Thiomicro... 36 0.43 UniRef50_Q01VQ3 Cluster: Zinc finger, CDGSH-type domain protein;... 36 0.43 UniRef50_A0ADG3 Cluster: Putative uncharacterized protein; n=1; ... 36 0.43 UniRef50_Q0EZX6 Cluster: Putative uncharacterized protein; n=1; ... 36 0.56 UniRef50_A0UWJ6 Cluster: Zinc finger, CDGSH-type; n=1; Clostridi... 36 0.74 UniRef50_Q9YBN8 Cluster: Putative uncharacterized protein; n=1; ... 36 0.74 UniRef50_Q12TU4 Cluster: Putative uncharacterized protein; n=3; ... 36 0.74 UniRef50_Q72XJ0 Cluster: Polysaccharide transport protein, putat... 35 0.98 UniRef50_A3HTD1 Cluster: Putative uncharacterized protein; n=1; ... 35 0.98 UniRef50_UPI000023E243 Cluster: hypothetical protein FG06770.1; ... 35 1.3 UniRef50_Q1LF05 Cluster: Zinc finger, CDGSH-type; n=5; Burkholde... 35 1.3 UniRef50_Q1ILJ1 Cluster: Zinc finger, CDGSH-type; n=1; Acidobact... 35 1.3 UniRef50_A0W6P3 Cluster: Zinc finger, CDGSH-type; n=4; Bacteria|... 35 1.3 UniRef50_Q8TQ72 Cluster: Putative uncharacterized protein; n=1; ... 35 1.3 UniRef50_UPI0000587C8D Cluster: PREDICTED: similar to putative s... 34 1.7 UniRef50_Q28SX5 Cluster: Putative uncharacterized protein; n=1; ... 34 1.7 UniRef50_A0L6Y7 Cluster: Zinc finger, CDGSH-type domain protein;... 34 1.7 UniRef50_Q9U3A1 Cluster: Putative uncharacterized protein; n=2; ... 34 1.7 UniRef50_Q4N226 Cluster: Putative uncharacterized protein; n=1; ... 34 1.7 UniRef50_A2A668 Cluster: Melanoma nuclear protein 13; n=4; Murin... 34 2.3 UniRef50_UPI000045BAB7 Cluster: COG0477: Permeases of the major ... 33 3.0 UniRef50_Q4RZN5 Cluster: Chromosome 18 SCAF14786, whole genome s... 33 3.0 UniRef50_A3ZLN0 Cluster: Putative uncharacterized protein; n=1; ... 33 3.0 UniRef50_UPI0000E4A91D Cluster: PREDICTED: similar to ENSANGP000... 33 4.0 UniRef50_A7RHW5 Cluster: Predicted protein; n=10; cellular organ... 33 4.0 UniRef50_Q9RJD1 Cluster: Putative uncharacterized protein SCO076... 33 5.2 UniRef50_Q05FQ9 Cluster: 3-isopropylmalate dehydratase small sub... 33 5.2 UniRef50_A4YPR1 Cluster: Putative uncharacterized protein; n=4; ... 33 5.2 UniRef50_A4IB30 Cluster: Putative uncharacterized protein; n=3; ... 33 5.2 UniRef50_A4YDE1 Cluster: Zinc finger, CDGSH-type domain protein;... 33 5.2 UniRef50_Q4AHF4 Cluster: Zn-finger, CDGSH type; n=4; Bacteria|Re... 32 6.9 UniRef50_A4CKI5 Cluster: Putative uncharacterized protein; n=1; ... 32 6.9 UniRef50_A5BU99 Cluster: Putative uncharacterized protein; n=1; ... 32 6.9 UniRef50_Q8I6X5 Cluster: Antigen B membrane protein; n=1; Rhipic... 32 6.9 UniRef50_Q584Z0 Cluster: Endosomal trafficking protein RME-8, pu... 32 6.9 UniRef50_UPI0000E46D0B Cluster: PREDICTED: similar to THO comple... 32 9.2 UniRef50_UPI0000DB7235 Cluster: PREDICTED: similar to CG3626-PA;... 32 9.2 UniRef50_Q44PJ1 Cluster: Zn-finger, CDGSH type; n=4; Chlorobiace... 32 9.2 UniRef50_Q0AIK3 Cluster: Zinc finger, CDGSH-type domain protein;... 32 9.2 UniRef50_A7MHD7 Cluster: Putative uncharacterized protein; n=1; ... 32 9.2 UniRef50_Q7Q987 Cluster: ENSANGP00000013261; n=4; cellular organ... 32 9.2 UniRef50_Q09JN4 Cluster: Putative secretory protein; n=1; Argas ... 32 9.2 UniRef50_Q4LCA6 Cluster: Adenine nucleotide carrier; n=1; Parano... 32 9.2 >UniRef50_Q9VAM6 Cluster: CG1458-PA; n=7; Endopterygota|Rep: CG1458-PA - Drosophila melanogaster (Fruit fly) Length = 133 Score = 188 bits (457), Expect = 9e-47 Identities = 82/132 (62%), Positives = 101/132 (76%), Gaps = 5/132 (3%) Frame = +3 Query: 45 MYVVSNLVKVTIPNYLSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYYSYQTIKKA 224 M +S+LVK ++PNYLSSLP+PDS+GGWF+L KDWLALIPPTVVV G+ Y +Y A Sbjct: 1 MEPISHLVKSSLPNYLSSLPVPDSIGGWFKLSFKDWLALIPPTVVVAGLGYTAYLAYCPA 60 Query: 225 REAG-----SGQINPCIRKDINKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNK 389 A SG+ N IRK+ KVVD ID+EDI EKA+ CRCW++KNWPYCDGSHG HNK Sbjct: 61 ARASCAAKNSGRCNNHIRKNEPKVVDMIDVEDIAEKAAFCRCWKTKNWPYCDGSHGEHNK 120 Query: 390 ETGDNTGPVVVR 425 +TGDN GP+V++ Sbjct: 121 QTGDNVGPIVIK 132 >UniRef50_Q7Z3D5 Cluster: Zinc finger CDGSH domain-containing protein 2; n=22; Euteleostomi|Rep: Zinc finger CDGSH domain-containing protein 2 - Homo sapiens (Human) Length = 150 Score = 120 bits (288), Expect = 3e-26 Identities = 57/128 (44%), Positives = 85/128 (66%), Gaps = 2/128 (1%) Frame = +3 Query: 54 VSNLVKVTIPNYLSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYYSYQT-IKKARE 230 V+ +VKV +P YL LP+P+S+ G+ RL V +WL L+P V+ + Y + + + K ++ Sbjct: 21 VARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQ 80 Query: 231 AGSGQINPCIRKDINKVVDFIDIEDIT-EKASLCRCWRSKNWPYCDGSHGPHNKETGDNT 407 IN I+K+ KVV+ I+IED+ KA+ CRCWRSK +P CDGSH HN+ TGDN Sbjct: 81 QKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNV 140 Query: 408 GPVVVRHK 431 GP++++ K Sbjct: 141 GPLILKKK 148 >UniRef50_Q15ES6 Cluster: CDGSH-type Zn finger-containing protein-like protein; n=2; Schistosoma|Rep: CDGSH-type Zn finger-containing protein-like protein - Schistosoma mansoni (Blood fluke) Length = 132 Score = 116 bits (280), Expect = 2e-25 Identities = 59/132 (44%), Positives = 76/132 (57%) Frame = +3 Query: 45 MYVVSNLVKVTIPNYLSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYYSYQTIKKA 224 M V+ +V P+ L S+PIP S FRL +KD LAL G I Y Y T+ Sbjct: 1 MNVLHTIVCDIAPDMLRSVPIPKSFRDIFRLSLKDVLALTVFGSFSGAIGYAVYTTVMLH 60 Query: 225 REAGSGQINPCIRKDINKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDN 404 IN I+K I K VD +DIE IT+K CRCWRS +PYCDG+H HN+ETGDN Sbjct: 61 LGKRKIPINYGIQKHITKCVDVVDIESITDKKVYCRCWRSSKFPYCDGAHNKHNEETGDN 120 Query: 405 TGPVVVRHKPAN 440 GP+++ K ++ Sbjct: 121 VGPLIIETKKSS 132 >UniRef50_A7T1B0 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 114 Score = 114 bits (274), Expect = 1e-24 Identities = 56/115 (48%), Positives = 69/115 (60%) Frame = +3 Query: 87 YLSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRK 266 YL +LP P S+GG F+L L L+P +V S Y +K +N K Sbjct: 1 YLENLPGPKSIGGIFKLDHNQVLQLVP---LVATTSVVVYALVKCFMPKKDEMVNLEKDK 57 Query: 267 DINKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHK 431 KV DF++IEDI +KA CRCWRSK +PYCDGSHG HNKETGDN GP++V K Sbjct: 58 HEEKVADFVEIEDIGDKAVFCRCWRSKKFPYCDGSHGAHNKETGDNVGPLIVHKK 112 >UniRef50_UPI0000585E9D Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 105 Score = 106 bits (255), Expect = 3e-22 Identities = 44/98 (44%), Positives = 63/98 (64%) Frame = +3 Query: 147 DWLALIPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKDINKVVDFIDIEDITEKASL 326 DWL ++P +G + + I++ + +G+GQ+N + KD KVV DIED+ +K + Sbjct: 7 DWLRMVPLVGTLGAVIVLTVMQIRRGKCSGNGQVNQSVEKDKAKVVHAFDIEDLGDKEAF 66 Query: 327 CRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHKPAN 440 CRCWRSK +P CDGSH HNK TGDN GP+ + K A+ Sbjct: 67 CRCWRSKTFPKCDGSHVGHNKATGDNVGPLCLSRKSAS 104 >UniRef50_Q58EB0 Cluster: Zgc:110843; n=2; Danio rerio|Rep: Zgc:110843 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 121 Score = 104 bits (250), Expect = 1e-21 Identities = 50/114 (43%), Positives = 68/114 (59%) Frame = +3 Query: 90 LSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKD 269 LS+L P + G F++ KD L I P V +S Y ++ + ++N I KD Sbjct: 8 LSALNKPGLIPG-FKVS-KDQLTTIVPVAVAAALSTYMLMRYFSSQSSPKSRVNLTINKD 65 Query: 270 INKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHK 431 KVV D+EDI KA CRCWRSK +PYCDG+H HN+ETGDN GP++++ K Sbjct: 66 SPKVVHSFDMEDIGSKAVYCRCWRSKKFPYCDGAHAKHNEETGDNVGPLIIKKK 119 >UniRef50_Q9NL51 Cluster: Kinesin like protein; n=5; Caenorhabditis|Rep: Kinesin like protein - Caenorhabditis elegans Length = 605 Score = 101 bits (243), Expect = 8e-21 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = +3 Query: 237 SGQINPCIRKDINKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPV 416 S + N I+ D NK+VD +DIEDI EK + CRCW+S+ WPYCDGSHG HNKETGDN GP+ Sbjct: 68 SARCNYKIQLDSNKIVDTVDIEDIGEKKAFCRCWKSEKWPYCDGSHGKHNKETGDNVGPL 127 Query: 417 VVR 425 +V+ Sbjct: 128 IVK 130 >UniRef50_Q9NZ45 Cluster: CDGSH iron sulfur domain-containing protein 1; n=24; Coelomata|Rep: CDGSH iron sulfur domain-containing protein 1 - Homo sapiens (Human) Length = 108 Score = 96.3 bits (229), Expect = 4e-19 Identities = 39/95 (41%), Positives = 57/95 (60%) Frame = +3 Query: 147 DWLALIPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKDINKVVDFIDIEDITEKASL 326 +W+A + I Y +Y+ IN I+KD K+V D+ED+ +KA Sbjct: 12 EWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVY 71 Query: 327 CRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHK 431 CRCWRSK +P+CDG+H HN+ETGDN GP++++ K Sbjct: 72 CRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106 >UniRef50_Q9FLI7 Cluster: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MIO24; n=2; Arabidopsis thaliana|Rep: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MIO24 - Arabidopsis thaliana (Mouse-ear cress) Length = 108 Score = 81.0 bits (191), Expect = 2e-14 Identities = 38/89 (42%), Positives = 54/89 (60%), Gaps = 1/89 (1%) Frame = +3 Query: 162 IPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKDINKVVDFIDIEDITEKAS-LCRCW 338 +P V GG Q + R G G INP IRK+ +KVVD + + ++++ + CRCW Sbjct: 18 LPFKPVTGGEVGRKQQRMVVVRAEGGGGINPEIRKNEDKVVDSVVVTELSKNITPYCRCW 77 Query: 339 RSKNWPYCDGSHGPHNKETGDNTGPVVVR 425 RS +P CDGSH HNK GDN GP++++ Sbjct: 78 RSGTFPLCDGSHVKHNKANGDNVGPLLLK 106 >UniRef50_Q0D6L9 Cluster: Os07g0467200 protein; n=3; Oryza sativa|Rep: Os07g0467200 protein - Oryza sativa subsp. japonica (Rice) Length = 109 Score = 81.0 bits (191), Expect = 2e-14 Identities = 36/67 (53%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +3 Query: 228 EAGSGQINPCIRKDINKVVDFIDIEDITEKAS-LCRCWRSKNWPYCDGSHGPHNKETGDN 404 EAG G INP IRK+ KVVD + ++++ + CRCWRS +P CDGSH HNK TGDN Sbjct: 42 EAGVGGINPSIRKEEEKVVDTVLAGELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDN 101 Query: 405 TGPVVVR 425 GP++V+ Sbjct: 102 VGPLLVK 108 >UniRef50_Q4T7B9 Cluster: Chromosome 1 SCAF8155, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1 SCAF8155, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 91 Score = 64.5 bits (150), Expect = 1e-09 Identities = 33/86 (38%), Positives = 44/86 (51%) Frame = +3 Query: 90 LSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKD 269 LSS+ +P + FRL K+ L + P V+ + + R G +N CI KD Sbjct: 6 LSSIAVPAASSSGFRLS-KEHLVVAVPVAVISAVGGFLVSQYMNRRCCKKGLVNTCISKD 64 Query: 270 INKVVDFIDIEDITEKASLCRCWRSK 347 KVV D+EDI KA CRCW+SK Sbjct: 65 SPKVVHSFDMEDIGSKAVYCRCWKSK 90 >UniRef50_Q55GD7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 145 Score = 53.2 bits (122), Expect = 3e-06 Identities = 21/44 (47%), Positives = 30/44 (68%) Frame = +3 Query: 291 IDIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVV 422 I ++ + +CRC +SKN+PYCDGSH +N+ETG N P+ V Sbjct: 36 IPVDPSSSDKWICRCGQSKNYPYCDGSHKKYNEETGLNDSPLKV 79 Score = 34.7 bits (76), Expect = 1.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 291 IDIEDITEKASLCRCWRSKNWPYCDGSH 374 + +E +E +CRC SK+ P+CDG+H Sbjct: 77 LKVEKGSEMVYVCRCGHSKDKPFCDGAH 104 >UniRef50_Q4N2P5 Cluster: Putative uncharacterized protein; n=1; Theileria parva|Rep: Putative uncharacterized protein - Theileria parva Length = 141 Score = 50.8 bits (116), Expect = 2e-05 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +3 Query: 294 DIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVV 419 D +D+ K +CRCW+SK +PYCDG+H E GDN GP V Sbjct: 32 DAKDV--KVCVCRCWQSKKFPYCDGTH-KLLMENGDNVGPYV 70 >UniRef50_Q7RKN6 Cluster: Putative uncharacterized protein PY02864; n=3; Plasmodium|Rep: Putative uncharacterized protein PY02864 - Plasmodium yoelii yoelii Length = 94 Score = 46.8 bits (106), Expect = 3e-04 Identities = 19/47 (40%), Positives = 31/47 (65%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHKPAN*IQIN 455 K S+CRCW+S +PYCD SH ++ G GP+++ + +N I++N Sbjct: 49 KISVCRCWKSNKFPYCDNSH-QKLQQQGVICGPLLLEVRKSNAIRLN 94 >UniRef50_A7ATI6 Cluster: Putative uncharacterized protein; n=1; Babesia bovis|Rep: Putative uncharacterized protein - Babesia bovis Length = 115 Score = 44.4 bits (100), Expect = 0.002 Identities = 19/39 (48%), Positives = 24/39 (61%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHKPAN 440 LCRCW+S +PYCD +H E GD+ GP V R + N Sbjct: 40 LCRCWQSHKFPYCDDTH-RLLVEAGDDVGPFVARLRSDN 77 >UniRef50_Q962M3 Cluster: PV1H14055_P; n=5; Plasmodium|Rep: PV1H14055_P - Plasmodium vivax Length = 152 Score = 42.7 bits (96), Expect = 0.005 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVR---HKPAN*IQINSKCSFQKNYVKTN 494 +CRCW+S +PYCD +H E GD+ GP V + +K ++ ++ + + + Y+K N Sbjct: 40 ICRCWQSAKFPYCDDTH-KILMENGDDVGPFVAKLSSYKLSDEEKLKQQ-KYNEKYIKLN 97 >UniRef50_A6UNI4 Cluster: Zinc finger CDGSH-type domain protein; n=2; Euryarchaeota|Rep: Zinc finger CDGSH-type domain protein - Methanococcus vannielii SB Length = 236 Score = 42.7 bits (96), Expect = 0.005 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 276 KVVDFIDIEDITEKASLCRCWRSKNWPYCDGSH 374 K +D+ I E SLCRC +SKN PYCDG+H Sbjct: 37 KNLDYEKEYPIKETYSLCRCGKSKNMPYCDGTH 69 Score = 40.7 bits (91), Expect = 0.020 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +3 Query: 297 IEDITEKASLCRCWRSKNWPYCDGSH 374 I +I + +LCRC +S+N PYCDGSH Sbjct: 194 IYEIRNRITLCRCGKSENKPYCDGSH 219 >UniRef50_Q54UZ7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 310 Score = 40.7 bits (91), Expect = 0.020 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPV 416 T +C C +S N P+CD SH NKET N P+ Sbjct: 104 TTTTLVCVCQQSSNLPFCDSSHEKFNKETNSNIQPI 139 >UniRef50_Q98DK7 Cluster: Mlr4660 protein; n=2; Alphaproteobacteria|Rep: Mlr4660 protein - Rhizobium loti (Mesorhizobium loti) Length = 208 Score = 39.9 bits (89), Expect = 0.035 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHKPA 437 +A+LCRC S+N P+CDGSHG K TG ++ PA Sbjct: 106 RATLCRCGASENKPFCDGSHG---KAGFTATGEPALKDAPA 143 Score = 37.9 bits (84), Expect = 0.14 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 303 DITEKASLCRCWRSKNWPYCDGSH 374 D T++ LCRC S N P+CDGSH Sbjct: 178 DRTQRTFLCRCGHSANKPFCDGSH 201 >UniRef50_A6TUK3 Cluster: Putative uncharacterized protein; n=1; Alkaliphilus metalliredigens QYMF|Rep: Putative uncharacterized protein - Alkaliphilus metalliredigens QYMF Length = 210 Score = 39.9 bits (89), Expect = 0.035 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +3 Query: 312 EKASLCRCWRSKNWPYCDGSHGPHNKE 392 ++ +LCRC SKN P+CDGSH P ++E Sbjct: 183 KRYTLCRCNNSKNKPFCDGSHIPKHEE 209 >UniRef50_A4EGN9 Cluster: Putative uncharacterized protein; n=1; Roseobacter sp. CCS2|Rep: Putative uncharacterized protein - Roseobacter sp. CCS2 Length = 213 Score = 39.9 bits (89), Expect = 0.035 Identities = 18/27 (66%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = +3 Query: 300 EDITEK--ASLCRCWRSKNWPYCDGSH 374 EDI K A+LCRC SKN P+CDGSH Sbjct: 29 EDIETKEVAALCRCGASKNKPFCDGSH 55 Score = 35.5 bits (78), Expect = 0.74 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSH 374 K LCRC SKN P+CDG+H Sbjct: 185 KYVLCRCGHSKNKPFCDGTH 204 >UniRef50_Q465J8 Cluster: Putative uncharacterized protein; n=2; Methanomicrobia|Rep: Putative uncharacterized protein - Methanosarcina barkeri (strain Fusaro / DSM 804) Length = 256 Score = 39.1 bits (87), Expect = 0.060 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = +3 Query: 303 DITEKASLCRCWRSKNWPYCDGSH 374 +I + +LCRC +S+N P+CDGSH Sbjct: 227 EIRNRVTLCRCGKSRNKPFCDGSH 250 Score = 35.1 bits (77), Expect = 0.98 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 306 ITEKASLCRCWRSKNWPYCDGSH 374 I ++ +LCRC +S N P+CDG+H Sbjct: 78 IRDRYALCRCGQSGNKPFCDGTH 100 >UniRef50_Q6LSF0 Cluster: Putative uncharacterized protein CG3420; n=2; Photobacterium profundum|Rep: Putative uncharacterized protein CG3420 - Photobacterium profundum (Photobacterium sp. (strain SS9)) Length = 95 Score = 38.7 bits (86), Expect = 0.080 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSHGPHNKE 392 TE+ LC+C +S N PYCDGSH ++++ Sbjct: 55 TEQRWLCQCKQSSNQPYCDGSHKAYSED 82 >UniRef50_Q02RN6 Cluster: Putative uncharacterized protein; n=3; Pseudomonas aeruginosa group|Rep: Putative uncharacterized protein - Pseudomonas aeruginosa (strain UCBPP-PA14) Length = 92 Score = 38.7 bits (86), Expect = 0.080 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSHGP 380 LCRC RS + PYCDGSH P Sbjct: 60 LCRCGRSADLPYCDGSHAP 78 >UniRef50_Q8PSP5 Cluster: Conserved protein; n=3; Methanosarcina|Rep: Conserved protein - Methanosarcina mazei (Methanosarcina frisia) Length = 241 Score = 38.7 bits (86), Expect = 0.080 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSHGPHNKE 392 + +LCRC +S+N PYCDGSH ++++ Sbjct: 205 RVTLCRCGKSENKPYCDGSHWMNSQQ 230 Score = 37.5 bits (83), Expect = 0.18 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +3 Query: 285 DFIDIEDITEKAS--LCRCWRSKNWPYCDGSH---GPHNKETGDNT 407 D IDI++ + + LCRC S+N P+CDG+H G ET T Sbjct: 43 DLIDIKEYPRREAYILCRCGSSENKPFCDGAHRKVGFDGSETASRT 88 >UniRef50_Q5ZXI8 Cluster: Glutamate synthetase; n=4; Legionella pneumophila|Rep: Glutamate synthetase - Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 /ATCC 33152 / DSM 7513) Length = 98 Score = 37.9 bits (84), Expect = 0.14 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +3 Query: 273 NKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSH 374 +K V FI ++TE C C ++KN P+CDGSH Sbjct: 45 DKAVSFI--AELTEDVYFCNCKQTKNPPFCDGSH 76 >UniRef50_Q18QM0 Cluster: Zinc finger, CDGSH-type; n=2; Desulfitobacterium hafniense|Rep: Zinc finger, CDGSH-type - Desulfitobacterium hafniense (strain DCB-2) Length = 229 Score = 37.9 bits (84), Expect = 0.14 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 294 DIEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGD 401 ++ ++ + +LCRC RS N P+CD +H P G+ Sbjct: 193 EVYEVRNRVALCRCGRSGNKPFCDATHVPIGFSDGE 228 Score = 35.9 bits (79), Expect = 0.56 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSH 374 +E+ LCRC +SK P+CDGSH Sbjct: 49 SEEYYLCRCGKSKKAPFCDGSH 70 >UniRef50_Q0W3Y6 Cluster: Putative uncharacterized protein; n=1; uncultured methanogenic archaeon RC-I|Rep: Putative uncharacterized protein - Uncultured methanogenic archaeon RC-I Length = 236 Score = 37.9 bits (84), Expect = 0.14 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSHGPHNKETGDNT 407 + +LCRC RS N P+CDGSH GD + Sbjct: 204 RVTLCRCGRSGNKPFCDGSHIDSEFNDGDES 234 Score = 33.1 bits (72), Expect = 4.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 312 EKASLCRCWRSKNWPYCDGSH 374 E +LCRC SK+ P+CDG H Sbjct: 53 EVYALCRCGESKHKPFCDGMH 73 >UniRef50_A6G5G8 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 219 Score = 37.5 bits (83), Expect = 0.18 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSH 374 +A+LCRC SKN P+CDG+H Sbjct: 192 RAALCRCGASKNKPFCDGAH 211 Score = 35.5 bits (78), Expect = 0.74 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 294 DIEDITEKASLCRCWRSKNWPYCDGSH 374 D+ + +A+LCRC SK P+CD SH Sbjct: 110 DMGGVRYRAALCRCGASKQKPFCDNSH 136 >UniRef50_A6DCD1 Cluster: Putative uncharacterized protein; n=1; Caminibacter mediatlanticus TB-2|Rep: Putative uncharacterized protein - Caminibacter mediatlanticus TB-2 Length = 61 Score = 37.5 bits (83), Expect = 0.18 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 297 IEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDN 404 IE + +CRC SK +PYCDGSH K+ DN Sbjct: 14 IEGKDKTIFICRCGLSKKFPYCDGSH-KRTKDEEDN 48 >UniRef50_A3UQB8 Cluster: Glutamate synthase domain protein; n=24; Bacteria|Rep: Glutamate synthase domain protein - Vibrio splendidus 12B01 Length = 520 Score = 37.5 bits (83), Expect = 0.18 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +3 Query: 297 IEDITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVV 419 + + T A LCRC S N P+CDG+H E GP V Sbjct: 51 VAEETGDAYLCRCKYSNNLPFCDGTHKQFTAEQVGQEGPDV 91 Score = 34.3 bits (75), Expect = 1.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 312 EKASLCRCWRSKNWPYCDGSH 374 E+ C C +SKN P+CDGSH Sbjct: 20 EEYYFCTCGKSKNQPFCDGSH 40 >UniRef50_Q4MMV8 Cluster: Conserved protein; n=16; Bacillaceae|Rep: Conserved protein - Bacillus cereus G9241 Length = 90 Score = 37.1 bits (82), Expect = 0.24 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 321 SLCRCWRSKNWPYCDGSH 374 SLCRC SKN PYCD SH Sbjct: 59 SLCRCGLSKNMPYCDASH 76 >UniRef50_Q5SME8 Cluster: Putative uncharacterized protein TTHA1309; n=2; Thermus thermophilus|Rep: Putative uncharacterized protein TTHA1309 - Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Length = 68 Score = 36.7 bits (81), Expect = 0.32 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSH 374 K +LCRC RS+ P+CDGSH Sbjct: 34 KLALCRCGRSREKPFCDGSH 53 >UniRef50_Q30RV3 Cluster: Zinc finger, CDGSH-type; n=1; Thiomicrospira denitrificans ATCC 33889|Rep: Zinc finger, CDGSH-type - Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1351) Length = 96 Score = 36.3 bits (80), Expect = 0.43 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSHGPHNKE 392 T++ +C C SKN+P+CDG+H + E Sbjct: 56 TKQYHICMCKSSKNFPFCDGTHSTYRDE 83 >UniRef50_Q01VQ3 Cluster: Zinc finger, CDGSH-type domain protein; n=1; Solibacter usitatus Ellin6076|Rep: Zinc finger, CDGSH-type domain protein - Solibacter usitatus (strain Ellin6076) Length = 77 Score = 36.3 bits (80), Expect = 0.43 Identities = 19/38 (50%), Positives = 22/38 (57%) Frame = +3 Query: 321 SLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHKP 434 SLCRC +S N P+CDGSH TG + PV R P Sbjct: 39 SLCRCGQSANKPFCDGSHA----RTG-FSDPVTARELP 71 >UniRef50_A0ADG3 Cluster: Putative uncharacterized protein; n=1; Streptomyces ambofaciens ATCC 23877|Rep: Putative uncharacterized protein - Streptomyces ambofaciens ATCC 23877 Length = 82 Score = 36.3 bits (80), Expect = 0.43 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSHGPHNKETGD 401 + +LC C RS+ +P+CD SH + TGD Sbjct: 48 RVALCTCRRSRRFPWCDTSHRARSSGTGD 76 >UniRef50_Q0EZX6 Cluster: Putative uncharacterized protein; n=1; Mariprofundus ferrooxydans PV-1|Rep: Putative uncharacterized protein - Mariprofundus ferrooxydans PV-1 Length = 213 Score = 35.9 bits (79), Expect = 0.56 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSH 374 +A LCRC SKN P+CDG+H Sbjct: 110 RAVLCRCGASKNKPWCDGAH 129 Score = 35.5 bits (78), Expect = 0.74 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSH 374 TE+ LCRC SK+ P+CD SH Sbjct: 184 TERTVLCRCGASKSKPFCDASH 205 >UniRef50_A0UWJ6 Cluster: Zinc finger, CDGSH-type; n=1; Clostridium cellulolyticum H10|Rep: Zinc finger, CDGSH-type - Clostridium cellulolyticum H10 Length = 65 Score = 35.5 bits (78), Expect = 0.74 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 303 DITEKASLCRCWRSKNWPYCDGSH 374 +++ + LCRC S+N P+CDGSH Sbjct: 31 EVSSELHLCRCGLSQNKPHCDGSH 54 >UniRef50_Q9YBN8 Cluster: Putative uncharacterized protein; n=1; Aeropyrum pernix|Rep: Putative uncharacterized protein - Aeropyrum pernix Length = 59 Score = 35.5 bits (78), Expect = 0.74 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSH 374 + +LCRC S N PYCDG+H Sbjct: 23 QTALCRCGHSNNKPYCDGTH 42 >UniRef50_Q12TU4 Cluster: Putative uncharacterized protein; n=3; cellular organisms|Rep: Putative uncharacterized protein - Methanococcoides burtonii (strain DSM 6242) Length = 211 Score = 35.5 bits (78), Expect = 0.74 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 252 PCIRKDINKVVDFI-DIEDITEKASLCRCWRSKNWPYCDGSH 374 P I K++N + + D + +LCRC S N P+CDG+H Sbjct: 15 PYIAKELNDLKNSKGDTFEPQSMVALCRCGHSSNKPFCDGTH 56 Score = 33.1 bits (72), Expect = 4.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 312 EKASLCRCWRSKNWPYCDGSH 374 E +LCRC SKN P+C G H Sbjct: 181 EHFTLCRCGASKNKPFCSGEH 201 >UniRef50_Q72XJ0 Cluster: Polysaccharide transport protein, putative; n=1; Bacillus cereus ATCC 10987|Rep: Polysaccharide transport protein, putative - Bacillus cereus (strain ATCC 10987) Length = 508 Score = 35.1 bits (77), Expect = 0.98 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +3 Query: 27 FAKSLKMYVVSNLVKVTIPNYLSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYY 200 F K + +Y +S++V + + L SL + DS WF G++ + T+++G + YY Sbjct: 430 FIKKIMVYALSSVVTILVVKLLPSLTL-DSYISWFIYGIEVAVIATLITILIGTVFYY 486 >UniRef50_A3HTD1 Cluster: Putative uncharacterized protein; n=1; Algoriphagus sp. PR1|Rep: Putative uncharacterized protein - Algoriphagus sp. PR1 Length = 143 Score = 35.1 bits (77), Expect = 0.98 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 294 DIEDITEKASLCRCWRSKNWPYCDGSH 374 ++E ++ + CRC SKN P+CDG+H Sbjct: 110 ELEKDSKVTAFCRCGGSKNKPFCDGTH 136 >UniRef50_UPI000023E243 Cluster: hypothetical protein FG06770.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG06770.1 - Gibberella zeae PH-1 Length = 301 Score = 34.7 bits (76), Expect = 1.3 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 120 GGWFR--LGVKDWLALIPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKD 269 GGWF G DW AL+ + VG + + Y +A+EAG+ P R D Sbjct: 143 GGWFSDGRGGTDWGALLFTIIFVGVLGWIIYSACYRAQEAGTNSNRPRRRGD 194 >UniRef50_Q1LF05 Cluster: Zinc finger, CDGSH-type; n=5; Burkholderiaceae|Rep: Zinc finger, CDGSH-type - Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) Length = 74 Score = 34.7 bits (76), Expect = 1.3 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSH 374 LCRC S+N P+CDGSH Sbjct: 45 LCRCGHSENKPFCDGSH 61 >UniRef50_Q1ILJ1 Cluster: Zinc finger, CDGSH-type; n=1; Acidobacteria bacterium Ellin345|Rep: Zinc finger, CDGSH-type - Acidobacteria bacterium (strain Ellin345) Length = 86 Score = 34.7 bits (76), Expect = 1.3 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 303 DITEKA--SLCRCWRSKNWPYCDGSH 374 D+T K SLCRC S N P+CDG+H Sbjct: 34 DLTGKTGFSLCRCGGSTNKPFCDGTH 59 >UniRef50_A0W6P3 Cluster: Zinc finger, CDGSH-type; n=4; Bacteria|Rep: Zinc finger, CDGSH-type - Geobacter lovleyi SZ Length = 113 Score = 34.7 bits (76), Expect = 1.3 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 303 DITEK--ASLCRCWRSKNWPYCDGSH 374 +ITEK LC C ++K P+CDGSH Sbjct: 86 EITEKQQVKLCNCGKTKTAPFCDGSH 111 >UniRef50_Q8TQ72 Cluster: Putative uncharacterized protein; n=1; Methanosarcina acetivorans|Rep: Putative uncharacterized protein - Methanosarcina acetivorans Length = 232 Score = 34.7 bits (76), Expect = 1.3 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 Query: 321 SLCRCWRSKNWPYCDGSH 374 +LCRC +S+N P+CDG+H Sbjct: 43 ALCRCGKSENKPFCDGAH 60 >UniRef50_UPI0000587C8D Cluster: PREDICTED: similar to putative secretory protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to putative secretory protein - Strongylocentrotus purpuratus Length = 125 Score = 34.3 bits (75), Expect = 1.7 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +3 Query: 270 INKVVDFIDIEDITEKASLCRCWRSKNWPYCDGSHGP 380 ++K++ + + +K S C+C SK P+CDG+H P Sbjct: 37 VSKLIPTMVKLEAGKKYSWCKCGLSKKQPFCDGAHKP 73 >UniRef50_Q28SX5 Cluster: Putative uncharacterized protein; n=1; Jannaschia sp. CCS1|Rep: Putative uncharacterized protein - Jannaschia sp. (strain CCS1) Length = 215 Score = 34.3 bits (75), Expect = 1.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSH 374 T+K +LCRC S P+CDG+H Sbjct: 185 TQKYALCRCGLSSTKPFCDGTH 206 >UniRef50_A0L6Y7 Cluster: Zinc finger, CDGSH-type domain protein; n=1; Magnetococcus sp. MC-1|Rep: Zinc finger, CDGSH-type domain protein - Magnetococcus sp. (strain MC-1) Length = 94 Score = 34.3 bits (75), Expect = 1.7 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSH 374 + S+CRC +S+++PYCD +H Sbjct: 71 QVSVCRCGKSRSFPYCDSTH 90 Score = 33.9 bits (74), Expect = 2.3 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSH 374 +CRC RSK P+CDGSH Sbjct: 38 ICRCGRSKLQPHCDGSH 54 >UniRef50_Q9U3A1 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 160 Score = 34.3 bits (75), Expect = 1.7 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +3 Query: 276 KVVDFIDIEDITEKASLCRCWRSKNWPYCDGSH 374 K V FI +D+T LC C ++ N P+CDGSH Sbjct: 116 KPVRFIPDKDMT--VWLCNCKQTNNRPFCDGSH 146 >UniRef50_Q4N226 Cluster: Putative uncharacterized protein; n=1; Theileria parva|Rep: Putative uncharacterized protein - Theileria parva Length = 102 Score = 34.3 bits (75), Expect = 1.7 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSHGPHNK---ETGDNT 407 +CRCW+S +P CD SH K + G NT Sbjct: 47 VCRCWKSAKFPLCDNSHQKLEKLGVDCGTNT 77 >UniRef50_A2A668 Cluster: Melanoma nuclear protein 13; n=4; Murinae|Rep: Melanoma nuclear protein 13 - Mus musculus (Mouse) Length = 137 Score = 33.9 bits (74), Expect = 2.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +3 Query: 327 CRCWRSKNWPYCDGSH 374 C C RSKN P+CDGSH Sbjct: 70 CVCGRSKNQPFCDGSH 85 >UniRef50_UPI000045BAB7 Cluster: COG0477: Permeases of the major facilitator superfamily; n=1; Nostoc punctiforme PCC 73102|Rep: COG0477: Permeases of the major facilitator superfamily - Nostoc punctiforme PCC 73102 Length = 1326 Score = 33.5 bits (73), Expect = 3.0 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = +2 Query: 92 VELADSRFCWRMVSS---WS*RLVSTDSAYSCSWRYILLLLPDNKKSQRSWQWSNKPLYQ 262 +E+A R WR + W+ LV + A +C Y L +LP SW WS KP Q Sbjct: 1065 LEVAGMRVYWRETAVGKFWAGPLVPWNGAIACVVAYFLYILP-----WESWGWSKKPWQQ 1119 Query: 263 EGH 271 + Sbjct: 1120 AAY 1122 >UniRef50_Q4RZN5 Cluster: Chromosome 18 SCAF14786, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 18 SCAF14786, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 134 Score = 33.5 bits (73), Expect = 3.0 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSH 374 LC C +KN PYCDGSH Sbjct: 100 LCACKETKNPPYCDGSH 116 >UniRef50_A3ZLN0 Cluster: Putative uncharacterized protein; n=1; Blastopirellula marina DSM 3645|Rep: Putative uncharacterized protein - Blastopirellula marina DSM 3645 Length = 68 Score = 33.5 bits (73), Expect = 3.0 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 321 SLCRCWRSKNWPYCDGSH 374 +LCRC +S N P+CDG+H Sbjct: 38 ALCRCGQSANRPFCDGAH 55 >UniRef50_UPI0000E4A91D Cluster: PREDICTED: similar to ENSANGP00000013261; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ENSANGP00000013261 - Strongylocentrotus purpuratus Length = 138 Score = 33.1 bits (72), Expect = 4.0 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +3 Query: 312 EKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVRHKPAN*IQINSKCSFQKN 479 +K C C SK P+CDG+H K+TG + V KP + QI C + K+ Sbjct: 44 KKKKWCTCGLSKKAPWCDGAH----KKTGFRSLKWEVPEKPQSVYQI-CNCKYTKS 94 >UniRef50_A7RHW5 Cluster: Predicted protein; n=10; cellular organisms|Rep: Predicted protein - Nematostella vectensis Length = 82 Score = 33.1 bits (72), Expect = 4.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 312 EKASLCRCWRSKNWPYCDGSH 374 ++ S CRC SK P+CDGSH Sbjct: 10 KRYSWCRCGLSKKQPFCDGSH 30 >UniRef50_Q9RJD1 Cluster: Putative uncharacterized protein SCO0761; n=1; Streptomyces coelicolor|Rep: Putative uncharacterized protein SCO0761 - Streptomyces coelicolor Length = 59 Score = 32.7 bits (71), Expect = 5.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 315 KASLCRCWRSKNWPYCDGSHGPHNKETGD 401 + +LC C RS+ +P+CD SH + D Sbjct: 21 RVALCTCRRSRRYPWCDTSHRARSARAAD 49 >UniRef50_Q05FQ9 Cluster: 3-isopropylmalate dehydratase small subunit; n=1; Candidatus Carsonella ruddii PV|Rep: 3-isopropylmalate dehydratase small subunit - Carsonella ruddii (strain PV) Length = 188 Score = 32.7 bits (71), Expect = 5.2 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -1 Query: 305 ILNVNKVHNFINVLPDTRVYLTTASFSGFFYCLVRVVRYTANYN 174 ILN+N + + ++P + +L T +GF+YCL +RY N N Sbjct: 9 ILNINNIDTDL-IIP--KQFLKTIKKTGFYYCLFYDLRYLINQN 49 >UniRef50_A4YPR1 Cluster: Putative uncharacterized protein; n=4; Bacteria|Rep: Putative uncharacterized protein - Bradyrhizobium sp. (strain ORS278) Length = 81 Score = 32.7 bits (71), Expect = 5.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSH 374 T+KA C C R+ N P CDG+H Sbjct: 55 TKKAFFCTCKRTANAPLCDGAH 76 >UniRef50_A4IB30 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania infantum Length = 120 Score = 32.7 bits (71), Expect = 5.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 327 CRCWRSKNWPYCDGSHGPHNKE 392 C C SK P+CDG+H +N+E Sbjct: 45 CSCGLSKTQPFCDGAHRAYNEE 66 >UniRef50_A4YDE1 Cluster: Zinc finger, CDGSH-type domain protein; n=2; Metallosphaera sedula DSM 5348|Rep: Zinc finger, CDGSH-type domain protein - Metallosphaera sedula DSM 5348 Length = 68 Score = 32.7 bits (71), Expect = 5.2 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVV 422 +C C S N P+CDGS H K +N G V V Sbjct: 25 ICACGLSNNKPFCDGS---HKKTQDENPGDVYV 54 >UniRef50_Q4AHF4 Cluster: Zn-finger, CDGSH type; n=4; Bacteria|Rep: Zn-finger, CDGSH type - Chlorobium phaeobacteroides BS1 Length = 81 Score = 32.3 bits (70), Expect = 6.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 327 CRCWRSKNWPYCDGSH 374 C C RS N P+CDGSH Sbjct: 26 CACGRSANQPFCDGSH 41 >UniRef50_A4CKI5 Cluster: Putative uncharacterized protein; n=1; Robiginitalea biformata HTCC2501|Rep: Putative uncharacterized protein - Robiginitalea biformata HTCC2501 Length = 141 Score = 32.3 bits (70), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 321 SLCRCWRSKNWPYCDGSH 374 + CRC S N P+CDGSH Sbjct: 117 AFCRCGASDNKPFCDGSH 134 >UniRef50_A5BU99 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 294 Score = 32.3 bits (70), Expect = 6.9 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 189 ISYYSYQTIKKAREAGSGQINPCIRKDINKVVDFIDIEDITEKASLCR 332 I +Y Y +K REA S +PCI + V+++I I +K S R Sbjct: 103 IGHYLYSACQKQREARSSHPSPCISSNPIAVINYIHGGSIDDKHSTRR 150 >UniRef50_Q8I6X5 Cluster: Antigen B membrane protein; n=1; Rhipicephalus microplus|Rep: Antigen B membrane protein - Boophilus microplus (Cattle tick) Length = 978 Score = 32.3 bits (70), Expect = 6.9 Identities = 21/76 (27%), Positives = 33/76 (43%) Frame = +3 Query: 162 IPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKDINKVVDFIDIEDITEKASLCRCWR 341 I P VV G S+ K + + G + D + V I ED ++ +L R Sbjct: 800 IRPEDVVNGTEACSHYAQKFSADYWEGAKGELMAPD-STTVTLISFEDCAKQCTLDPSGR 858 Query: 342 SKNWPYCDGSHGPHNK 389 K++ +C G GP+ K Sbjct: 859 CKSFNFCPGDDGPNRK 874 >UniRef50_Q584Z0 Cluster: Endosomal trafficking protein RME-8, putative; n=3; Trypanosoma|Rep: Endosomal trafficking protein RME-8, putative - Trypanosoma brucei Length = 2236 Score = 32.3 bits (70), Expect = 6.9 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = -1 Query: 278 FINVLPDTRVYLTTASFSGFFYCLVRVVRYTANYNCRRNQC*PIFNSKTKPSANRIWNRQ 99 F+NV ++ A G + L+R++ T N CR + C + K S N++W + Sbjct: 1827 FLNVALPECAFVQQAFDRGLYVLLLRIIATTTNPECRNDACLAL----VKISTNKLWGPK 1882 Query: 98 A 96 A Sbjct: 1883 A 1883 >UniRef50_UPI0000E46D0B Cluster: PREDICTED: similar to THO complex 2; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to THO complex 2 - Strongylocentrotus purpuratus Length = 1592 Score = 31.9 bits (69), Expect = 9.2 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -1 Query: 332 SAKGCLLSYILN-VNKVHNFINVLPDTRVYLTTASFSGFFYCLVRVV 195 S G L SY+L+ + N I + D+ YLT+ SF YC++ + Sbjct: 569 SNPGVLFSYVLSQIQMYDNLIGPVVDSLKYLTSLSFDILAYCVIEAL 615 >UniRef50_UPI0000DB7235 Cluster: PREDICTED: similar to CG3626-PA; n=2; Apis mellifera|Rep: PREDICTED: similar to CG3626-PA - Apis mellifera Length = 660 Score = 31.9 bits (69), Expect = 9.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 185 RYILLLLPDNKKSQRSWQWSNKPLYQEGH**SCGLY*H*GY 307 +Y+ LLL D+ +W W N+P+++ G CG+ GY Sbjct: 546 KYVQLLLNDHDPELDTWCWGNEPIFRNGK--YCGMTTTTGY 584 >UniRef50_Q44PJ1 Cluster: Zn-finger, CDGSH type; n=4; Chlorobiaceae|Rep: Zn-finger, CDGSH type - Chlorobium limicola DSM 245 Length = 78 Score = 31.9 bits (69), Expect = 9.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 327 CRCWRSKNWPYCDGSH 374 C C +S+N PYCDG+H Sbjct: 23 CACGKSQNKPYCDGAH 38 >UniRef50_Q0AIK3 Cluster: Zinc finger, CDGSH-type domain protein; n=2; Nitrosomonas|Rep: Zinc finger, CDGSH-type domain protein - Nitrosomonas eutropha (strain C71) Length = 79 Score = 31.9 bits (69), Expect = 9.2 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 303 DITEKASLCRCWRSKNWPYCDGSHGPHNKETGDNTGPVVVR 425 +I ++ CRC S++ P+CDGSH + G N P +R Sbjct: 17 EIGKRYYWCRCGLSQSQPFCDGSH----RGAGINPVPFTIR 53 >UniRef50_A7MHD7 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 254 Score = 31.9 bits (69), Expect = 9.2 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 10/104 (9%) Frame = +3 Query: 51 VVSNLVKVTIPNYLSSLPIPDSVGGWFRLGVKDWLALIPPTVVVGGISYYSYQTIKKA-- 224 ++SNLV + +P++ S L I DS+ R +W +I G + K Sbjct: 1 MMSNLVSIIMPSWNSELTIADSINSIIRQTYTNWELIITDDCSSDGTIRLLKEFANKEPR 60 Query: 225 -------REAGSG-QINPCIRKDINKVVDFIDIEDITEKASLCR 332 + +G+G N CI+ + + F+D +D+ L R Sbjct: 61 IKLFFNDKNSGAGISRNNCIKNAKGRFIAFLDSDDMWHPEKLSR 104 >UniRef50_Q7Q987 Cluster: ENSANGP00000013261; n=4; cellular organisms|Rep: ENSANGP00000013261 - Anopheles gambiae str. PEST Length = 142 Score = 31.9 bits (69), Expect = 9.2 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 324 LCRCWRSKNWPYCDGSH 374 LC C ++KN P+CDG+H Sbjct: 115 LCNCKQTKNRPFCDGTH 131 >UniRef50_Q09JN4 Cluster: Putative secretory protein; n=1; Argas monolakensis|Rep: Putative secretory protein - Argas monolakensis Length = 135 Score = 31.9 bits (69), Expect = 9.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 309 TEKASLCRCWRSKNWPYCDGSH 374 T+K LCRC ++ N P+CD SH Sbjct: 97 TKKYLLCRCKQTNNRPFCDLSH 118 >UniRef50_Q4LCA6 Cluster: Adenine nucleotide carrier; n=1; Paranosema grylli|Rep: Adenine nucleotide carrier - Paranosema grylli Length = 548 Score = 31.9 bits (69), Expect = 9.2 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +3 Query: 123 GWFRLGVKDWLALIPPTVVVGGISYYSYQTIKKAREAGSGQINPCIRKDINKVVD 287 G+ +G WL + ++V G Y + ++EA S +INP R + D Sbjct: 411 GFVSIGENLWLEQLLGAIIVTGFKILKYSAVDVSKEALSMRINPAYRARFKGIYD 465 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 496,318,417 Number of Sequences: 1657284 Number of extensions: 9972018 Number of successful extensions: 29215 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 28402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29203 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -