BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302G05f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 0.82 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 5.8 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.2 bits (50), Expect = 0.82 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 155 STDSAYSCSWRYILLLLPDNKKSQRSWQWSNK 250 S + + + W ++L LL D + R +W+N+ Sbjct: 452 SREGSTTYLWEFLLKLLQDREYCPRYIKWTNR 483 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 5 SARGFSLFC*KLKNVR 52 S +GFSLF LKN R Sbjct: 178 SGKGFSLFARFLKNPR 193 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,223 Number of Sequences: 438 Number of extensions: 2981 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -