BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS302F12f (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 1.5 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 3.5 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 3.5 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 4.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 4.6 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 6.1 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 324 TVSRVCDTLDITLRP 368 T+SR+ D DI LRP Sbjct: 40 TISRILDGYDIRLRP 54 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = +2 Query: 197 RQATGHGCVKFGGVRYDQVEKAKVQCKALDGIEC 298 R T H C G++ E ++ K + +EC Sbjct: 102 RHITLHHCYDADGIKLMNEENGVMEIKIREPVEC 135 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = +2 Query: 197 RQATGHGCVKFGGVRYDQVEKAKVQCKALDGIEC 298 R T H C G++ E ++ K + +EC Sbjct: 102 RHITLHHCYDADGIKLMNEENGVMEIKIREPVEC 135 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.4 bits (43), Expect = 4.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 308 DCHNIQFHPRLCTEL 264 DC NI P++ TEL Sbjct: 122 DCRNIGAVPKMATEL 136 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 4.6 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +2 Query: 161 DEPIDHKGNHTARQATGHGCVKFGG 235 ++P+D N GHG K+ G Sbjct: 263 EKPLDVSSNDKVHPLYGHGVCKWPG 287 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.0 bits (42), Expect = 6.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 331 ETVTRKASTAITFNSIQGFALNFSFLNLIISDTSKF 224 +T + +TAI + + F FSFL L + S F Sbjct: 347 DTCCQGRATAIYIDKVSRFFFPFSFLILNVVYWSTF 382 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,366 Number of Sequences: 438 Number of extensions: 2564 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -